AlderconeStudio/PIKApp
AlderconeStudio
/
PIKApp
0
0
Fork 0
Code Issues 1 Pull Requests Packages Projects Releases 1 Wiki Activity
PIKApp/upstream-documentation/ChangeLog.pre-2-2

21167 lines
683 KiB
Plaintext
Raw Blame History

This file contains invisible Unicode characters

This file contains invisible Unicode characters that are indistinguishable to humans but may be processed differently by a computer. If you think that this is intentional, you can safely ignore this warning. Use the Escape button to reveal them.

2004-12-19 Sven Neumann <sven@gimp.org>
* Made 2.2.0 release.
2004-12-18 Sven Neumann <sven@gimp.org>
* app/tools/gimprotatetool.c (gimp_rotate_tool_dialog): fixed label.
2004-12-18 Sven Neumann <sven@gimp.org>
* app/dialogs/resize-dialog.c: free the dialog's private data
struct using a weak reference, not in a "destroy" handler. Should
fix bug #161472.
* app/dialogs/print-size-dialog.c
* app/dialogs/scale-dialog.c: same change here.
2004-12-18 Sven Neumann <sven@gimp.org>
* app/dialogs/quit-dialog.c: marked a message for translation that
had been forgotten. Fixes bug #161596.
2004-12-17 Sven Neumann <sven@gimp.org>
* autogen.sh: check for gtk-doc.m4, depend on intltool > 0.31.
2004-12-17 Sven Neumann <sven@gimp.org>
* app/tools/gimpmovetool.c (gimp_move_tool_cursor_update): don't
use the rect-select cursor if the tool is in move-layer mode.
Spotted by Joao S. O. Bueno, bug #161465.
2004-12-17 Simon Budig <simon@gimp.org>
* app/tools/gimpcurvestool.c: Kill some nonsensical code that
tried to set control points in a free form curve based on the
image coordinates (huh?). Update the Graph after adding a point.
Untabbified.
2004-12-17 Sven Neumann <sven@gimp.org>
* app/tools/gimpimagemaptool.c (gimp_image_map_tool_pick_color):
take drawable offsets into account. Fixes bug #161508.
2004-12-17 Sven Neumann <sven@gimp.org>
* docs/gimp-remote.1.in
* docs/gimp.1.in
* docs/gimptool.1.in: minor tweaks.
2004-12-17 Simon Budig <simon@gimp.org>
* data/images/gimp-splash.png: Added new splash by
Bill Luhtala <bluhtala@telus.net>.
* data/images/gimp-logo.png: Added new Image for the about dialog
by Philip Lafleur <deathpudding@gmail.com>.
* app/dialogs/about-dialog.c: Adjusted text colors and placement
to the new image.
* data/images/gimp2_0_logo.png
* data/images/gimp2_0_splash.png: Added for historical reasons.
* data/images/gimp_logo.png: Removed (renamed to gimp-logo.png)
* data/images/Makefile.am: changed accordingly.
2004-12-16 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/core/gimpgradient-load.c: reject .ggr files whose
segments don't properly span the range 0-1.
Fixes bug #161430.
2004-12-16 Manish Singh <yosh@gimp.org>
* app/widgets/gimppdbdialog.c (gimp_pdb_dialog_set_property): Cast
result of g_value_dup_object() to GIMP_CONTEXT().
2004-12-16 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/script-fu/scripts/circuit.scm: don't try to
desaturate a grayscale layer, fixes bug #161470.
2004-12-16 Sven Neumann <sven@gimp.org>
* INSTALL: updated location of fontconfig sources.
2004-12-16 Sven Neumann <sven@gimp.org>
* app/config/gimpconfig-dump.c
* docs/gimp-remote.1.in
* docs/gimp.1.in
* docs/gimprc.5.in: hyphens revisited.
2004-12-16 Sven Neumann <neumann@jpk.com>
* app/config/gimpconfig-dump.c (dump_gimprc_manpage): escape hyphens.
* docs/gimp.1.in: documented the way that splash images are choosen.
* docs/gimprc.5.in: regenerated.
2004-12-16 Michael Natterer <mitch@gimp.org>
* app/actions/actions.c (action_data_get_*): get gimp, display or
image from a context only if it isn't NULL. Fixes warnings and
crashes when dragging around some dockables (the dockables'
context temporarily becomes NULL while dragging).
Reordered checks for the passed "data" to be consistent across the
various functions.
Removed assertions which said "#warning: remove me before 2.2"
2004-12-16 Sven Neumann <neumann@jpk.com>
* app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog):
added a note on how to use the dialog, copied from the GNOME keyboard
shortcuts editor.
2004-12-15 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/text_tool.pdb: let gimp_text() and
gimp_text_fontname() succeed but return -1 if no layer was created.
Fixes bug #161272.
* app/pdb/text_tool_cmds.c
* libgimp/gimptexttool_pdb.c: regenerated.
2004-12-15 Michael Natterer <mitch@gimp.org>
* app/core/gimpdrawable-preview.[ch]: added utility function
gimp_drawable_preview_bytes() and use it. Some cleanup,
untabified.
* app/widgets/gimpviewrendererdrawable.c: use
gimp_drawable_preview_bytes() instead of duplicating its code.
2004-12-15 Michael Natterer <mitch@gimp.org>
Sven Neumann <sven@gimp.org>
* app/core/gimpdrawable-preview.c (gimp_drawable_preview_scale):
fixed RGBA resampling by using premultiplied values for the
intermediate accumulation buffer. Fixes bugs #72880 and #72881.
2004-12-14 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in-proc-frame.[ch]: added "gint ref_count" to
the PlugInProcFrame struct. Added new functions
plug_in_proc_frame_ref/unref().
(plug_in_proc_frame_new): set the ref_count to 1.
* app/plug-in/plug-in.[ch] (plug_in_proc_frame_push): return the
new proc_frame.
(plug_in_proc_frame_pop): use unref() instead of free().
* app/plug-in/plug-in-run.c (plug_in_temp_run): ref the proc_frame
while running its main loop. Removed the call to
plug_in_proc_frame_pop().
* app/plug-in/plug-in-message.c (plug_in_handle_temp_proc_return):
call plug_in_proc_frame_pop() immediately after
plug_in_main_loop_quit() so the proc_frame goes away from the
stack and can't be used accidentially if the core is too busy to
return to the main loop before the next command arrives on the
wire. Really fixes bug #161114 this time.
2004-12-14 Simon Budig <simon@gimp.org>
* app/vectors/gimpstroke.[ch]: Changed the "gradient" parameter
to "slope" to make it more clear what the returned result is (which
was wrong earlier).
* tools/pdbgen/pdb/paths.pdb: changed accordingly
* app/pdb/paths_cmds.c
* libgimp/gimppaths_pdb.[ch]: regenerated.
Fixes bug #161274.
2004-12-14 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/imagemap/imap_selection.c: don't use
gtk_tree_selection_get_selected with GTK_SELECTION_MULTIPLE. Should
finally fix bug #149157.
2004-12-14 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpstock.c (gimp_stock_init): documented.
2004-12-14 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_misc.c (make_toolbar_radio_icon): don't
call gtk_radio_tool_button_new_with_stock_from_widget() with a
NULL widget. Fixes bug #161210.
2004-12-14 Sven Neumann <sven@gimp.org>
* configure.in: added GIMP_API_VERSION to the generated gimpversion.h.
* libgimpbase/gimpenv.c (gimp_toplevel_directory): use
GIMP_API_VERSION instead of GIMP_MACRO_VERSION.GIMP_MINOR_VERSION
when building a path to test the plug-in executable path against.
2004-12-14 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/drawable.pdb: added gimp_drawable_sub_thumbnail()
to enable plug-ins avoiding #142074-alike bugs if they need to.
* app/pdb/drawable_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpdrawable_pdb.[ch]: regenerated.
* libgimp/gimpdrawable.[ch]
* libgimp/gimppixbuf.[ch]: wrap it with the same convenience
APIs as gimp_drawable_thumbnail().
* libgimp/gimp.def
* libgimp/gimpui.def: changed accordingly.
2004-12-13 Sven Neumann <sven@gimp.org>
* HACKING
* autogen.sh
* configure.in: switched to using gtkdocize for the build of the
API docs.
2004-12-13 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/imagemap/imap_selection.c: don't try do to anything when
selection is empty. Fixes bug #149157.
2004-12-13 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/imagemap/imap_misc.[ch]
* plug-ins/imagemap/imap_selection.[ch]
* plug-ins/imagemap/imap_toolbar.[ch]
* plug-ins/imagemap/imap_tools.[ch]: removed need for
GTK_DISABLE_DEPRECATED. Looking at #149157 next...
2004-12-13 Sven Neumann <sven@gimp.org>
* app/tools/gimpcroptool.c: don't show the Crop tool window if
Shift is being pressed on the initial button_press event.
2004-12-13 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/pygimp/gimpfu.py: display PF_RADIO options vertically
instead of horizontally, as suggested by Joao S. O. Bueno Calligaris.
Fixes bug #160546.
2004-12-13 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/gfig/gfig.c: make the "gfig" layer parasites persistent,
so that they will be saved in xcf files. Stop printing "GFig
parasite found" message.
2004-12-13 Michael Natterer <mitch@gimp.org>
* app/widgets/gimppdbdialog.[ch]: don't forget the context we
were created with but rmember it as pdb_dialog->caller_context.
* app/widgets/gimpbrushselect.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c: use the caller_context when
calling the temp_proc so the temp_proc's stack frame doesn't
contain the dialog's private context (which is just a scratch
model for the container views) but the plug-in's real context
which is fully initialized. Fixes bug #161114.
2004-12-13 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablecombobox.c: fixed gtk-doc comment.
2004-12-13 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-style.c: let objects keep their own fill_style
context.
2004-12-13 Sven Neumann <sven@gimp.org>
* app/core/gimpimage-convert.c: applied patch from Adam D. Moss with
more fixed dither improvements (bug #161123).
2004-12-13 Sven Neumann <sven@gimp.org>
* app/gui/splash.c: restrict splash image to screen size to guard us
from insanely large splash images.
2004-12-13 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdock.c (gimp_dock_delete_event): invert logic so
everything except GTK_RESPONSE_OK keeps the dock open
(e.g. hitting escape).
2004-12-12 Michael Natterer <mitch@gimp.org>
* app/core/gimpdrawable-preview.c (gimp_drawable_get_sub_preview):
added precondition check for the coords of the src area. Some
cleanup and simplification.
* app/widgets/gimpviewrendererdrawable.c
(gimp_view_renderer_drawable_render): don't request sub-previews
of area outside the drawable and don't reuqest previews of zero
width or height. Fixes crashes with the new preview code.
2004-12-12 Sven Neumann <sven@gimp.org>
Applied patch from Adam D. Moss (bug #161113):
* app/core/gimpimage-convert.c: Use a slower but much nicer
technique for finding the two best colours to dither between when
using fixed/positional dither methods. Makes positional dither
much less lame.
2004-12-12 Sven Neumann <sven@gimp.org>
* plug-ins/common/film.c (film): push a context around code that
changes the foreground color.
2004-12-12 Sven Neumann <sven@gimp.org>
* app/batch.c (batch_run): changed handling of the 'gimp -b -'
command-line. It used to spawn three instances of Script-Fu, two
should be more than enough.
2004-12-12 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpdataeditor.c: make Revert button insensitive
because revert is not yet implemented (bug #152259).
2004-12-12 Sven Neumann <sven@gimp.org>
* app/widgets/gimpdock.c: show a confirmation dialog if a dock
with multiple tabs is being closed. Sorry for the new strings,
they were carefully copied from gnome-terminal.
2004-12-12 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/pnm.c: make export do the right thing when
saving as .pgm or .ppm. Fixes bug #160045.
2004-12-12 Sven Neumann <sven@gimp.org>
* libgimp/gimp.def: added gimp_edit_copy_visible.
* plug-ins/script-fu/scripts/copy-visible.scm: deprecated.
2004-12-12 Sven Neumann <sven@gimp.org>
* plug-ins/common/winclipboard.c: applied patch from Brion Vibber
that adds an alpha channel to the pasted layer. Fixes bug #148601.
2004-12-12 Sven Neumann <sven@gimp.org>
* app/base/tile-manager-crop.c: removed trailing whitespace.
* plug-ins/imagemap/imap_selection.c: need to define
GTK_DISABLE_DEPRECATED for gtk_toolbar_append_space().
2004-12-12 Michael Natterer <mitch@gimp.org>
* app/paint-funcs/paint-funcs.[ch]: added new function
copy_region_nocow() as a workaround for the fact that sharing
tiles with the projection is heavily broken.
* app/base/tile-manager.c (tile_invalidate): added a warning when
entering the code path that breaks badly.
* app/core/gimp-edit.[ch]: added gimp_edit_copy_visible(), using
the non-COW copying function above.
* app/widgets/gimphelp-ids.h: added GIMP_HELP_COPY_VISIBLE.
* app/actions/edit-actions.c
* app/actions/edit-commands.[ch]: added action & callback for
"edit-copy-visible".
* menus/image-menu.xml.in: added "edit-copy-visible" to the image
menu.
* tools/pdbgen/pdb/edit.pdb: added gimp_edit_copy_visible()
PDB wrapper.
* app/pdb/edit_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpedit_pdb.[ch]: regenerated.
* plug-ins/script-fu/scripts/copy-visible.scm: removed all code
and made it a backward compat wrapper around gimp-edit-copy-visible.
Fixes bug #138662.
2004-12-11 Michael Natterer <mitch@gimp.org>
* app/core/gimpdrawable-preview.c (gimp_drawable_preview_private):
implement it using gimp_drawable_get_sub_preview(). Removes
massive code duplication introduced by yesterday's fix.
2004-12-11 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/copy-visible.scm: Apply the layer mask
when copying a single layer with a layer mask. Fixes bug #138662.
* plug-ins/script-fu/scripts/t-o-p-logo.scm: Removed ' character.
2004-12-11 Sven Neumann <sven@gimp.org>
* INSTALL
* NEWS
* README: updates for the GIMP 2.2.0 release.
2004-12-11 Sven Neumann <sven@gimp.org>
* plug-ins/common/unsharp.c: got rid of a global variable.
* plug-ins/common/bumpmap.c (dialog_bumpmap_callback): more changes
to restore the gimp-2.0 behaviour.
2004-12-11 Michael Natterer <mitch@gimp.org>
* app/core/gimpdrawable-preview.[ch]: added new function
gimp_drawable_get_sub_preview() which returns a scaled preview of
a part of a drawable.
(gimp_drawable_preview_scale): made it work with srcPR.x and
srcPR.y being != 0.
* app/core/gimpimage-preview.c (gimp_image_get_new_preview)
* app/widgets/gimpviewrendererdrawable.c
(gimp_view_renderer_drawable_render): if the area of the drawable
preview is more than 4 times larger than the drawable itself (evil
heuristic, but seems to work fine), use above function to get a
sub-preview of the drawable instead of getting an insanely large
preview of the whole drawable just to use a small part of it.
Fixes bug #142074.
* app/core/gimpimage-preview.c (gimp_image_get_new_preview):
optimized by skipping layers which do not intersect with the
canvas.
2004-12-11 Sven Neumann <sven@gimp.org>
* plug-ins/common/bumpmap.c (dialog_bumpmap_callback): do actually
change the bumpmap drawable. Fixes bug #160985, hopefully without
reopening bug #158494.
2004-12-11 Sven Neumann <sven@gimp.org>
* configure.in: set version to 2.2.0.
* tools/Makefile.am
* tools/authorsgen/Makefile.am
* tools/authorsgen/authorsgen.pl
* tools/authorsgen/contributors: removed authorsgen, a perl script
that used to be used to create AUTHORS and authors.h.
* Makefile.am
* authors.dtd
* authors.xml: added a simple XML file that lists authors and
contributors and a DTD to validate it.
* authors.xsl: a stylesheet to generate AUTHORS from authors.xml.
* app/dialogs/Makefile.am
* app/dialogs/authors.xsl: a stylesheet to generate authors.h from
authors.xml.
* app/dialogs/authors.h: regenerated.
* app/dialogs/about-dialog.c: added a const modifier.
2004-12-09 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimphistogrameditor.c: make histogram editor,
and therefore histogram dialog, use the selection. Should
resolve bug #72959.
* app/core/gimpdrawable-histogram.h: remove trailing whitespace.
2004-12-10 Manish Singh <yosh@gimp.org>
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c: #include <string.h> for strcmp()
2004-12-10 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdatafactoryview.c
(gimp_data_factory_view_tree_name_edited)
* app/widgets/gimpitemtreeview.c
(gimp_item_tree_view_name_edited)
* app/widgets/gimptemplateview.c
(gimp_template_view_tree_name_edited): call gimp_object_set_name()
or gimp_item_rename() only if the item's name has actually changed
and restore the old text otherwise. Fixes one instance of "name is
not updated correctly after editing" for which I blamed GTK+ in
bug #145463 :-) The other instances should be fixed in GTK+ HEAD
and are imho unfixable with GTK+ 2.4.
2004-12-10 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainertreeview.c
(gimp_container_tree_view_clear_items): clear all viewable cell
renderers so they don't keep pointers to layers/masks which don't
exist any more. Fixes the additional problem in bug #148852 but
not the bug itself.
2004-12-09 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/core/gimpbrushpipe.c (gimp_brush_pipe_select_brush):
Don't initialize a new random number generator every time a brush
is selected from a pipe. Fixes bug #148205).
2004-12-09 DindinX <dindinx@gimp.org>
* plug-ins/common/cartoon.c: marked the menu entry for translation
(reported by Zigomar)
2004-12-09 Michael Natterer <mitch@gimp.org>
* app/dialogs/print-size-dialog.c
* app/widgets/gimpsizebox.c: set a focus_chain on the size_entries
so the focus order is width->height->chain->unitmenu and not
width->chain->height->unitmenu.
* app/widgets/gimptemplateeditor.c: changed focus_chain code to
work like above (cosmetics).
2004-12-09 Sven Neumann <sven@gimp.org>
* app/gui/splash.c (splash_update): only expose the area of the
window that actually changed.
* app/plug-in/plug-in-rc.c (plug_in_rc_write): changed the header
and footer to be more in line with the other rc files.
2004-12-08 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/dialogs/print-size-dialog.c (print_size_dialog_size_changed):
Previous fix only worked if units were inches -- now seems to
work for all units. (fixes #159273 ?)
2004-12-08 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/randomize.c: Changed algorithm for Pick and
Slur to treat all channels within a pixel in the same way;
intended to fix bug #72852.
2004-12-08 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/dialogs/print-size-dialog.c (print_size_dialog_size_changed):
fixed kludgy use of size entry, seems to fix bug #159273.
2004-12-08 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpuimanager.[ch]: renamed
gimp_ui_manager_get_action() to gimp_ui_manager_find_action().
* app/widgets/gimpcolormapeditor.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimppaletteeditor.c
* app/widgets/gimptoolbox.c
* app/widgets/gimptooloptionseditor.c
* app/display/gimpdisplayshell-close.c: changed accordingly.
(this change is quite useless as it stands, but will help keeping
the diff between 2.2 and 2.3 small as soon as we're branched).
* app/widgets/gimpcolormapeditor.c
(gimp_colormap_preview_button_press): invoke the "edit-color", not
"new-color" action upon double click.
(palette_editor_select_entry): update the ui manager after
selecting the entry so the entry-specific actions become sensitive
if there was no entry selected before.
2004-12-08 Michael Natterer <mitch@gimp.org>
* app/widgets/gimppropwidgets.[ch]: added new prop_widget
gimp_prop_int_combo_box_new() which takes a pre-built GimpIntStore
and allows to create views on int properties with arbitrary sets
of values (not just enums).
* app/widgets/gimpcontrollereditor.c
(gimp_controller_editor_constructor): added support for generic
combo boxes controlled exclusively by controller properties: if an
int property "foo" is followed by an object property "foo-values"
and the contained object is a GimpIntStore, use that store as
model for selecting "foo"'s values using
gimp_prop_int_combo_box_new().
(Allows for more flexible controller configuration, the actual use
case in the midi controller is still work in progress).
2004-12-06 Sven Neumann <sven@gimp.org>
* tools/authorsgen/contributors: removed duplicate entry for Roman.
* AUTHORS
* app/dialogs/authors.h: regenerated.
2004-12-06 Roman Joost <romanofski@gimp.org>
* tools/authorsgen/contributors: added Róman Joost to
contributors
2004-12-06 Michael Natterer <mitch@gimp.org>
* app/tools/gimptransformtool.c: applied patch from Sven Neumann
which removes code that prevents layers with mask from being
transformed.
* app/tools/gimptransformtool.[ch]: added "gboolean mask_empty"
parameter to GimpTransformTool::transform(). Needed because the
selection gets cleared by cutting from the drawable and we need
the selection's state before that cutting.
(gimp_transform_tool_doit): pass "mask_empty" to
GimpTransformTool::transform():
* app/tools/gimptransformtool.c (gimp_transform_tool_real_transform)
* app/tools/gimpfliptool.c (gimp_flip_tool_transform): when
transforming a layer with mask and there is no selection,
transform the mask just as if it was a linked item.
Fixes bug #143837 and bug #159697.
2004-12-05 Sven Neumann <sven@gimp.org>
* app/core/gimp-transform-utils.c (gimp_transform_matrix_flip_free):
applied patch from Joao S. O. Bueno that fixes bug #160339.
2004-12-05 Sven Neumann <sven@gimp.org>
* plug-ins/help/domain.c
* plug-ins/help/gimp-help-lookup.c
* plug-ins/help/help.[ch]: if the help files are not installed,
uninstall the temporary procedure and quit. Fixes bug #160258.
2004-12-05 Sven Neumann <sven@gimp.org>
* plug-ins/common/lic.c: applied patch from Joao S. O. Bueno that
sets a lower limit for the filter length (bug #160121). The patch
also makes the plug-in work on drawables with alpha channel.
2004-12-05 Sven Neumann <sven@gimp.org>
* plug-ins/common/wmf.c: applied patch from Karine Proot that
limits the size of the preview in the WMF loader (bug #133521).
2004-12-04 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-arc.c
* plug-ins/gfig/gfig-arc.h
* plug-ins/gfig/gfig-bezier.c
* plug-ins/gfig/gfig-bezier.h
* plug-ins/gfig/gfig-circle.c
* plug-ins/gfig/gfig-circle.h
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig-dobject.h
* plug-ins/gfig/gfig-ellipse.c
* plug-ins/gfig/gfig-ellipse.h
* plug-ins/gfig/gfig-line.c
* plug-ins/gfig/gfig-line.h
* plug-ins/gfig/gfig-poly.c
* plug-ins/gfig/gfig-poly.h
* plug-ins/gfig/gfig-preview.c
* plug-ins/gfig/gfig-spiral.c
* plug-ins/gfig/gfig-spiral.h
* plug-ins/gfig/gfig-star.c
* plug-ins/gfig/gfig-star.h: updating a object is now a virtual
function.
2004-12-03 Michael Natterer <mitch@gimp.org>
* app/core/gimpimage-undo-push.c (undo_pop_layer): when removing
the floating selection, call gimp_drawable_invalidate_boundary()
*before* setting gimage->floating_sel to NULL because otherwise
gimp_display_shell_selection_invis() won't clear the correct
selection bounds and leave garbage on screen. Fixes bug #160247.
2004-12-02 Michael Natterer <mitch@gimp.org>
* app/actions/tool-options-actions.c
(tool_options_actions_update_presets): don't forget to initialize
the "value_variable" boolean of GimpEnumActionEntry. Fixes myriads
of warnings about wrong values for boolean properties.
* app/actions/file-actions.c (file_actions_setup): same
here. Fixes nothing but is cleaner.
2004-12-02 Simon Budig <simon@gimp.org>
* app/vectors/gimpvectors.c: Fixed stupid typo that caused
distorted vectors on scaling after resizing. Spotted by
Joao S. O. Bueno.
Fixes bug #157852.
2004-12-01 Sven Neumann <sven@gimp.org>
* autogen.sh: rephrased the warning that is shown when the
intltool check fails.
2004-12-01 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpuimanager.c (gimp_ui_manager_ui_get): improved
error message about missing XML files.
2004-12-01 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell-appearance.c
* app/display/gimpdisplayshell.c
* app/widgets/gimpdockable.c
* app/widgets/gimptexteditor.c
* app/widgets/gimptoolbox.c: check if gimp_ui_manager_ui_get()
actually returns something. Prevents crashes caused by missing
ui manager xml files. Fixes bug #159346.
2004-12-01 Michael Natterer <mitch@gimp.org>
* app/widgets/gimptoolview.c (gimp_tool_view_select_item): no need
to update the ui manager here, the parent class already does it.
2004-11-30 DindinX <dindinx@gimp.org>
* plug-ins/gfig/README: removed some very obsolete stuff.
* plug-ins/gfig/gfig-arc.c
* plug-ins/gfig/gfig-arc.h
* plug-ins/gfig/gfig-bezier.c
* plug-ins/gfig/gfig-bezier.h
* plug-ins/gfig/gfig-circle.c
* plug-ins/gfig/gfig-circle.h
* plug-ins/gfig/gfig-dobject.c: small cleanups
2004-11-30 Michael Natterer <mitch@gimp.org>
* app/gui/themes.c (themes_init): use gtk_rc_parse() instead of
gtk_rc_add_default_file() to add ~/.gimp-2.2/themerc to the list
of files parsed by GTK+ because the latter works only before
gtk_init(). Fixes bug #155963.
2004-11-30 Michael Natterer <mitch@gimp.org>
* app/dialogs/print-size-dialog.c: reordered prototypes to match
order of implementations.
2004-11-30 Sven Neumann <sven@gimp.org>
* app/sanity.c: we check for the same version of freetype on all
platforms, no need for an ifdef here.
2004-11-30 Sven Neumann <sven@gimp.org>
* libgimp/gimpexport.c: some more HIG-ification tweaks to the
Export dialogs.
2004-11-30 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpactiongroup.c
(gimp_action_group_set_action_color)
(gimp_action_group_set_action_color): allow to set color and
viewable to NULL, GimpAction handles this nicely. Fixes warnings
some foo_actions_update() functions were triggering.
2004-11-30 DindinX <dindinx@gimp.org>
* plug-ins/gfig/*[ch]: code cleanup
2004-11-29 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/display.pdb: make it work as documented (fail
if the new_image already has a display). Also fail if the
old_image doesn't have any display (changed docs accordingly).
On success, take over the initial reference count of the new
image, just as the gimp_display_new() PDB wrapper does.
Fixes bug #159051.
* app/pdb/display_cmds.c
* libgimp/gimpdisplay_pdb.c: regenerated.
2004-11-29 Sven Neumann <sven@gimp.org>
* app/file/file-save.c (file_save_as): when the image filename
changes, forget the filename that was last used with "save-a-copy".
2004-11-29 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback):
change the "update" property and notify listeners (in particular
GimpDrawablePreview) before invalidating the preview. Plug-ins
might (needlessly) look at the property to decide whether they
need to redraw. Fixes bug #159816.
* plug-ins/common/unsharp.c (preview_update): no need to look at
the value of the "Preview" toggle. GimpPreview takes care this.
2004-11-29 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c: issue a repaint after the
"show previous", "show next" and "show all" callbacks.
* plug-ins/gfig/gfig-style.c: fixed some comments.
2004-11-29 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_preview.c
* plug-ins/imagemap/imap_selection.c: undeprecated.
2004-11-28 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dobject.c: copy the style of the object when
pushing it to the undo stack, so undoing works as expected.
2004-11-28 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-style.c
* plug-ins/gfig/gfig-style.h: create a new function to get the current
style instead of using a global pointer for this
(gfig_context_get_current_style ())
* plug-ins/gfig/gfig-circle.c
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig.h: use this function everywhere it is needed. And
remove the current_style field from GfigContext.
(unrelated):
* plug-ins/FractalExplorer/Dialogs.h
* plug-ins/FractalExplorer/FractalExplorer.c: small cleanups
2004-11-28 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-style.[ch]
* plug-ins/gfig/gfig.h: removed unused stack of styles. Removed
gimp_style from GFigContext.
2004-11-28 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig.c (run): push a context for GFig.
2004-11-28 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.[ch]
* plug-ins/gfig/gfig-dobject.c: renamed undo_water_mark to undo_level.
Fixed the style handling when clearing the whole thing and undoing in
some very particular cases. The undo part should certainly be redone
to some extent.
Btw, this is the revision 1.10000 of the ChangeLog, yeah!
2004-11-28 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/gfig/gfig-style.c: make sure PaintType is saved and
loaded with the style.
2004-11-28 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c: correctly initializes the paint_type
field of the default style.
* plug-ins/gfig/gfig-style.c: don't print an useless error message
where no-one can see it when loading an other with no style but use
the default style instead.
2004-11-28 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig-dialog.[ch]
* plug-ins/gfig/gfig-dobject.c: moved Undo and Clear to the Edit
menu. Added a utility function to set the sensitivity of an action
by name. Cleaned up action callbacks.
* plug-ins/gfig/gfig-style.c: minor cleanup.
2004-11-28 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-arc.c
* plug-ins/gfig/gfig-bezier.c
* plug-ins/gfig/gfig-circle.c
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-ellipse.c
* plug-ins/gfig/gfig-line.c
* plug-ins/gfig/gfig-poly.c
* plug-ins/gfig/gfig-spiral.c
* plug-ins/gfig/gfig-star.c: made the class name uppercase since it is
used to parse a gfig file.
2004-11-28 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig-dialog.c: make sure that widgets in the Grid
and Preferences dialogs are only accessed while the dialogs exist.
2004-11-28 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig-dialog.c: made the Grid and Preferences
dialogs singletons and declared them as transient to the GFig
window. Don't let them run their own main loop.
2004-11-28 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig-dialog.c: added a Close menu item to the
menubar. Removed help buttons from popup dialogs. Set the same
default directory in load and save filechoosers.
2004-11-27 Manish Singh <yosh@gimp.org>
* tools/pdbgen/pdb/drawable_transform.pdb: escape utf8 as hex, to
avoid perl trying to be so smart that it's stupid.
* app/pdb/drawable_transform_cmds.c: regenerated.
2004-11-27 Manish Singh <yosh@gimp.org>
* plug-ins/common/jpeg.c (save_image): thumbnail buffer variable
declarations should be guarded under HAVE_EXIF.
2004-11-27 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/plug-ins/colorxhtml.py: s/colorhtml/colorxhtml/,
so it doesn't clash with the perl version.
* plug-ins/pygimp/plug-ins/Makefile.am: reflect filename change.
2004-11-27 Sven Neumann <sven@gimp.org>
* plug-ins/common/jpeg.c: delay the creation of the display for
the export image preview until the user requests a preview. Fixes
bug #159376.
2004-11-27 Øyvind Kolås <pippin@gimp.org>
* libgimp/gimpexport.c: minor layout adjustments for HIG compliance.
2004-11-27 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/spyrogimp.scm: Force number of teeth
to be integer values. Changed default for Outer teeth to give a
more interesting image. Detabified file. Fixes bug #158448.
2004-11-27 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc):
don't look at the menu path to determine if the script is
image-based. Instead look at the number of parameters we are being
called with.
2004-11-27 Sven Neumann <sven@gimp.org>
* app/tools/gimpinkoptions-gui.c: made the Size scale logarithmic
as suggested in bug #159632.
2004-11-27 Sven Neumann <sven@gimp.org>
* plug-ins/common/tiff.c (save_image): tell the user that we can't
handle indexed images with alpha channel (bug #159600).
2004-11-27 Sven Neumann <sven@gimp.org>
* app/main.c
* app/widgets/gimpenumstore.h
* app/widgets/gimpunitstore.c
* plug-ins/common/retinex.c: applied patch by Tim Mooney that
removes extraneous ;
2004-11-27 Sven Neumann <sven@gimp.org>
* plug-ins/common/wmf.c (run): applied patch by Tim Mooney that
increase the size of values[] to accomodate the use of
file_wmf_load_thumb (bug #159601).
2004-11-27 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/drawable.pdb: minor change to the PDB docs.
* libgimp/gimpdrawable_pdb.c
* tools/pdbgen/pdb/drawable.pdb: regenerated.
2004-11-27 Sven Neumann <sven@gimp.org>
* plug-ins/winicon/icosave.c
* plug-ins/winicon/main.[ch]: moved code around.
2004-11-26 Manish Singh <yosh@gimp.org>
* plug-ins/common/dog.c: make sure the preview image type matches
the source image type.
2004-11-26 Sven Neumann <sven@gimp.org>
* plug-ins/winicon/icosave.c: don't fiddle with the source image,
a save plug-in should save, nothing else.
* plug-ins/winicon/main.[ch]: handle all sorts of image types.
Fixes bug #157803.
2004-11-26 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/drawable.pdb: fixed docs for
gimp_drawable_type_with_alpha().
* app/pdb/drawable_cmds.c
* libgimp/gimpdrawable_pdb.c: regenerated.
2004-11-26 Sven Neumann <sven@gimp.org>
* plug-ins/winicon/main.[ch] (ico_image_get_reduced_buf)
* plug-ins/winicon/icodialog.c
* plug-ins/winicon/icoload.c
* plug-ins/winicon/icosave.c: fixed drawable handling. This
plug-in is still a complete mess and needs a lot more work.
2004-11-26 Sven Neumann <sven@gimp.org>
* app/tools/gimppaintoptions-gui.c (gimp_paint_options_gui): only
show the Incremental toggle for tools that use it (bug #159306).
2004-11-26 Sven Neumann <sven@gimp.org>
* app/core/gimpdocumentlist.c (gimp_document_list_deserialize):
don't add documents w/o a name to the list. Fixes bug #159510.
* app/core/gimpdrawable.c (gimp_drawable_resize): extended the
check to take the offsets into account as well.
2004-11-25 Manish Singh <yosh@gimp.org>
* plug-ins/common/dog.c: Add the temporary layers to the image, so
things work. Fixes bug #158895.
* plug-ins/common/iwarp.c: Fix same naughtiness as above. There's
other naughtiness still though.
* plug-ins/common/sunras.c: use gboolean for byte2bit invert argument.
2004-11-25 Manish Singh <yosh@gimp.org>
* plug-ins/common/jpeg.c: Use a jpeg_error_mgr that lives within
PreviewPersistent, instead of an automatic variable in save_image.
Fixes bug #159076.
2004-11-25 Simon Budig <simon@gimp.org>
* modules/controller_linux_input.c: Add some sample code to retrieve
the name of the connected MIDI device (ALSA).
Do not set the "name" when connected to Alsa, since snd_seq_name()
returns an uninteresting name.
2004-11-24 Michael Natterer <mitch@gimp.org>
* app/gui/gui.c (gui_display_changed): if the active display
becomes NULL (e.g. by closing a view), don't leave the user
context with an image but no display. Instead, try to find another
display of the same image and if that fails set the image to NULL.
Prevents the various foo_actions_update() functions from being
called with a NULL display while there is still an active image in
the context.
Fixes bug #159304.
(Removed #warning about being misplaced from that function because
it's a typical piece of ugly glue code that belongs exactly here).
2004-11-24 Simon Budig <simon@gimp.org>
* modules/controller_linux_input.c: Accept >= 0 return values of the
ioctl() to figure out the device name. Apparently it is the number of
bytes written to the string, so we might omit the strlen() following,
but I don't like to rely on that...
2004-11-24 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcontroller.[ch]: guarded the whole header
with GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION because it's no
fixed API yet. Added a "state" property bacause "name" was abused
as the controller's state. Added "help_domain" to the controller
class.
* libgimpwidgets/gimpwidgets.h: don't include gimpcontroller.h
* modules/controller_linux_input.c
* modules/controller_midi.c: set the "name" property to the name
retrieved from the device, or to a default string if no name is
available. Store the status in the "state" property. Added and
changed some strings, but it's better to have the controller
strings untranslated than to have no tooltips at all or misleading
labels.
* app/widgets/gimpcontrollerkeyboard.c
* app/widgets/gimpcontrollerwheel.c: set default strings for both.
* app/widgets/gimpcontrollereditor.c: added a GUI for the "state"
property.
* app/widgets/gimpcontrollerkeyboard.h
* app/widgets/gimpcontrollerwheel.h
* app/widgets/gimpcontrollerinfo.c
* app/widgets/gimpcontrollers.c: #define
GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION (just as in all files
above).
* app/widgets/gimphelp-ids.h: added the IDs of all controller
modules and also of all other modules. The defines are not
actually used, but this file is the canonical place to collect all
the core's help IDs.
2004-11-23 Sven Neumann <sven@gimp.org>
* app/core/gimp-templates.[ch]
* app/dialogs/user-install-dialog.c: merge the migrated user
templaterc with the system templaterc so the users who have used
gimp-2.0 before get our changes to the default templates.
2004-11-23 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpwidgets-utils.[ch]: added new function
gimp_toggle_button_set_visible() which can be used as "toggled"
callback on a GtkToggleButton and sets a widget (in)visible
according to the toggle's "active" state.
* app/tools/gimpblendoptions.c
* app/tools/gimppaintoptions-gui.c
* app/tools/gimpselectionoptions.c: use it to hide (rather than
just insensitize) the seldomly used "Feather edges", "Autoshrink
selection", "Adaptive supersampling", "Fade out" and "Use color
from gradient" widgets when their enabling toggle is unchecked.
Makes the affected tool options much less crowded and noisy in
their default appearance. Fixes bug #159008.
2004-11-23 Michael Natterer <mitch@gimp.org>
* app/menus/plug-in-menus.c (plug_in_menus_add_proc): create
dynamic sub-menus using a separate, ui-manager-global merge_id
instead of the procedure's merge_id. Has the effect that the ui
manager keeps around these sub-menus forever, even if the
procedure that initially registered them is unregistered.
Fixes menu ordering after Script-Fu->Refresh.
2004-11-23 Michael Natterer <mitch@gimp.org>
* app/core/gimpparasitelist.c: cosmetics, untabified.
* libgimpbase/gimpparasiteio.[ch]: added g_return_if_fail()'s
to all functions.
(gimp_pixpipe_params_parse): changed "gchar*" param to "const
gchar*" (sortof API change, but these files are most probably only
used by GIMP itself). Still uses strtok() on the internal copy,
but at least not on the passed string.
* plug-ins/common/csource.c
* plug-ins/common/gif.c
* plug-ins/common/gih.c
* plug-ins/common/jpeg.c
* plug-ins/common/png.c
* plug-ins/common/tiff.c: use parasite getters instead of
accessing the scruct members directly. Always use g_strndup()
instead of just g_strdup() to get strings stored in parasites
because there is no guarantee that they are nul-terminated.
2004-11-23 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_file.c (do_file_save_as_dialog): do
actually use a save dialog here. Fixes bug #159194.
2004-11-23 Sven Neumann <sven@gimp.org>
* app/core/gimpdrawable.c (gimp_drawable_resize): do nothing if
the size doesn't change. This keeps text layers from being
modified when an image is cropped and the layer is entirely inside
the cropped area.
* menus/image-menu.xml.in: put the Quit item back for now. We
should think about this again in the next development cycle.
2004-11-22 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/copy-visible.scm: Fixed incorrect
comparison in if statement. Partial(?) fix for bug #138662.
2004-11-22 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/Makefile.am
* plug-ins/pygimp/pygimp-logo.png: New pygimp logo, by Carol Spears.
* plug-ins/pygimp/gimpfu.py: Use new external logo file, some layout
tweaks.
2004-11-22 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontrollerinfo.c (gimp_controller_info_init):
always create the event mapping table. Fixes tons of warnings and
non-functional controller mapping dialog when an empty controller
was deserialized from controllerrc. Spotted by drc.
2004-11-22 Sven Neumann <sven@gimp.org>
* app/app_procs.c (app_exit_after_callback): call base_exit()
before quitting the application using exit(). Fixes bug #159019.
* app/base/tile-swap.c: moved the warning about a non-empty swap
file into #ifdef GIMP_UNSTABLE ... #endif.
2004-11-22 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c: correctly initialize the Antialising
check box. Reported by Zigomar.
2004-11-22 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/script-fu-scripts.c: sort the SFMenu structs
by their menu_paths *and* the procedure's menu_labels. Fixes menu
item sorting after "Refresh".
2004-11-22 Michael Natterer <mitch@gimp.org>
* app/tools/gimptextoptions.[ch] (gimp_text_options_editor_new):
added a "menu_factory" parameter instead of trying to get it from
the toplevel GimpDock (which does not exists if the tool options
dialog does not exist). Fixes bug #159071.
* app/tools/gimptexttool.c (gimp_text_tool_editor): pass the
menu_factory.
* app/dialogs/dialogs.c (dialogs_init): pass the global menu
factory also when constructing the "toplevel" dialog factory so
the above works.
2004-11-22 Michael Natterer <mitch@gimp.org>
* libgimpbase/gimputils.c (gimp_any_to_utf8): use g_strndup()
instead of g_strdup() if a length was passed.
* app/dialogs/info-window.c: g_strndup() the comment parasite's
data and pass -1 as length to gimp_any_to_utf8() so we don't
encounter the questionable (buggy?) behavior of g_utf8_validate()
to fail upon finding '\0' within the "length" passed.
Fixes bug #159051.
2004-11-22 Michael Natterer <mitch@gimp.org>
* plug-ins/common/struc.c: applied patch from Wolfgang Hofer
which makes the plug-in use its procedure name for
storing the "last_vals" struct. Fixes bug #159028.
* plug-ins/common/tileit.c: ditto. Fixes bug #159029.
2004-11-22 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-line.c: fixed a stupid bug which made all lines
half-selected.
2004-11-22 Sven Neumann <sven@gimp.org>
* app/dialogs/file-open-location-dialog.c: changed border-size of
GimpContainerEntry to 0.
2004-11-21 Sven Neumann <sven@gimp.org>
* tools/gimp-remote.c: added --no-splash command-line option that
is passed to gimp. Addresses Debian bug report #277989.
* docs/gimp-remote.1.in: document the new option.
2004-11-21 Manish Singh <yosh@gimp.org>
* configure.in: reverted previous change, as not all the lv.pos are
in CVS yet.
2004-11-21 Peteris Krisjanis <pecisk@gmail.com>
* configure.in: Added Latvian (lv) language support to ALL_LINGUAS.
2004-11-21 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/erase-rows.scm: Applied patch from BM
which makes the script work layers that have their top-left corner
at a position other than the top-left corner of the image.
Fixes bug #158863.
2004-11-21 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-arc.c
* plug-ins/gfig/gfig-bezier.c
* plug-ins/gfig/gfig-circle.c
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig-ellipse.c
* plug-ins/gfig/gfig-line.c
* plug-ins/gfig/gfig-poly.c
* plug-ins/gfig/gfig-spiral.c
* plug-ins/gfig/gfig-star.c
* plug-ins/gfig/gfig.h: makes which object is selected more obvious by
using filled handles for the selected object. Not perfect, but
certainly a good hint.
2004-11-21 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-preview.c: call gfig_grid_colours() in the
realize callback of the preview, so the gray gc of the grid works
again. Reported by Zigomar.
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig-preview.h
* plug-ins/gfig/gfig-spiral.h
* plug-ins/gfig/gfig-star.h
* plug-ins/gfig/notes.txt: small cosmetics fixes.
2004-11-21 Sven Neumann <sven@gimp.org>
* plug-ins/common/compose.c
* plug-ins/common/decompose.c: transfer the image resolution to
newly created images.
2004-11-21 Sven Neumann <sven@gimp.org>
* plug-ins/gimpressionist/Brushes/snow1.pgm: reverted a change
that Hans Breuer committed here, probably accidentally.
* plug-ins/script-fu/script-fu.c
* plug-ins/script-fu/siod-wrapper.c: reverted Hans's changes. There
is indeed a Script-Fu server on Win32.
2004-11-21 Sven Neumann <sven@gimp.org>
* menus/image-menu.xml.in: removed "Quit" from the image menu.
2004-09-21 Hans Breuer <hans@breuer.org>
* app/dialogs/makefile.msc : [new file]
app/dialogs/Makefile.am : added to EXTRA_DIST
* **/makefile.msc app/gimpcore.def : updated
* app/gimp.rc : let wilber be first
* app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either
* libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib
* libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32
* plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h
* plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/script-fu.c :
there is no script-fu-server on win32
2004-11-21 Michael Schumacher <schumaml@cvs.gnome.org>
* plug-ins/script-fu/scripts/addborder.scm: first resize the
image, then add the border layer and then fill it
2004-11-20 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/script-fu-scripts.c: Need to call gettext in
script-fu_menu_compare. Spotted by Sven. Removed obsolete #define's.
2004-11-20 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/script-fu-scripts.c: renamed variable
"script_list" to "script_tree" because it's a GTree.
(script_fu_remove_script): g_list_free() the right list (don't
leak all lists of scripts at the tree leaves).
2004-11-20 Sven Neumann <sven@gimp.org>
* Made 2.2-pre2 release.
2004-11-20 Sven Neumann <sven@gimp.org>
* plug-ins/common/glob.c: added an (optional) parameter that
allows to request the output in the filesystem encoding.
2004-11-19 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-scripts.c (script_fu_menu_compare):
compare the menu paths, not the struct pointers.
2004-11-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/glob.c: added a naive glob() implementation
which handles the most common use case and is certainly better
than nothing. Closes bug #143661 again.
2004-11-19 Sven Neumann <sven@gimp.org>
* libgimp/gimp.c: converted a g_warning() to g_printerr().
2004-11-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/xpm.c: just some minor code cleanup.
2004-11-19 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-style.c: combined two "Stroke" labels into a
single one.
2004-11-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/noisify.c: applied a (modified) patch that adds
the possibility to correlate the noise with the signal. Adds the
new PDB procedure "plug_in_scatter_rgb". Fixes bug #158700.
* plug-ins/helpbrowser/dialog.c: set a reasonable default size.
2004-11-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/postscript.c (skip_ps) (ps_close): fixed use of
fread(). Unfortunately this slowed down the plug-in again.
Disabled the code that reads the pipe to the end. This brings it
back to speed. Seems to work fine for me, let's see if this causes
problems for anyone...
2004-11-19 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/selection-round.scm: moved into the
<Image>/Select/Modify menu now that we can safely use placeholders
from Script-Fu.
2004-11-19 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/lib.pl
* tools/pdbgen/stddefs.pdb: added support for deprecated procedures
without any replacement.
* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): added
a special warning for procedures without replacement.
* tools/pdbgen/pdb/drawable.pdb: deprecated drawable_set_image()
without any replacement and made it a nop (which fails if the
passed image is different from the drawable's image). It's not
needed any longer since 2.0 and moreover dangerous to use.
* app/pdb/drawable_cmds.c
* libgimp/gimpdrawable_pdb.[ch]: regenerated.
* app/core/gimpitem.c (gimp_item_set_image): replaced assertion
for gimp_item_is_floating() by !gimp_item_is_attached(). The
former warned when adding a layer with already added mask to the
image (which is a perfectly valid operation).
2004-11-18 Sven Neumann <sven@gimp.org>
* plug-ins/common/wmf.c: added a thumbnail load procedure
(bug #158193).
2004-11-18 Michael Natterer <mitch@gimp.org>
Script-Fu string cleanup/simplification: apply the same fix for
menu path translation that was done for plug-ins a while ago.
* plug-ins/script-fu/script-fu.c (script_fu_auxillary_init): use
gimp_plugin_menu_register() on the "Refresh" temp_proc.
* plug-ins/script-fu/scripts/*.scm: ported all scripts to use
script-fu-menu-register and pass just the menu label in
script-fu-register. Cleaned up all register calls to share a
somewhat similar formatting.
2004-11-18 Sven Neumann <sven@gimp.org>
* plug-ins/common/postscript.c: changed the default to load only
the first page of the document and added a tooltip describing how
to specify what pages to get.
2004-11-18 Sven Neumann <sven@gimp.org>
* app/file/file-open.c (file_open_thumbnail): fixed check for
number of return values.
2004-11-18 Sven Neumann <sven@gimp.org>
* plug-ins/common/postscript.c: speed up loading of multi-page
documents significantly by skipping in large chunks instead of using
fgetc() to crawl through the stream.
2004-11-18 Sven Neumann <sven@gimp.org>
* app/file/file-open.c (file_open_thumbnail): check the number of
return values. Only retrieve width and height if the thumbnail
load procedure does actually provide this information.
* plug-ins/common/postscript.c: added a procedure to load a
thumbnail. For now it only renders the first page of the
document at low resolution. It should be extended to load an
embedded thumbnail if one is available.
* plug-ins/common/jpeg.c
* plug-ins/common/svg.c: no need to register a menu label for the
thumbnail loaders. Allocate the return_vals array large enough to
hold all return values.
2004-11-18 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpenumaction.[ch]: added boolean property
"value-variable" which specifies if the GimpEnumAction::selected()
signal may be emitted with arbirtary values (value-variable = TRUE)
or *only* with enum_action->value (value-variable = FALSE).
* app/widgets/gimpactiongroup.[ch]: added "gboolean
value_variable" to GimpEnumActionEntry and set it in
gimp_action_group_add_enum_actions().
* app/actions/channels-actions.c
* app/actions/colormap-editor-actions.c
* app/actions/context-actions.c
* app/actions/drawable-actions.c
* app/actions/edit-actions.c
* app/actions/error-console-actions.c
* app/actions/gradient-editor-actions.c
* app/actions/image-actions.c
* app/actions/layers-actions.c
* app/actions/palette-editor-actions.c
* app/actions/plug-in-actions.c
* app/actions/vectors-actions.c
* app/actions/view-actions.c: set "variable" to FALSE for all enum
actions except those which are used with the GIMP_ACTION_SELECT_SET
voodoo.
* app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
fall back to gtk_action_activate() if the action specified in a
GIMP_CONTROLLER_EVENT_VALUE mapping is not variable. Enables
triggering of enum actions from GIMP_CONTROLLER_EVENT_VALUE events
(like midi note-on and note-off).
2004-11-18 Michael Natterer <mitch@gimp.org>
* acinclude.m4: pasted the complete alsa.m4 so compiling from
CVS doesn't require alsa.m4 to be installed.
* configure.in: check for alsa >= 1.0.0 and define HAVE_ALSA
if found.
* modules/Makefile.am: build controller_midi with ALSA_CFLAGS
and ALSA_LIBS.
* modules/controller_midi.c: s/HAVE_ALSALIB_H/HAVE_ALSA/.
2004-11-18 Michael Natterer <mitch@gimp.org>
* plug-ins/common/compressor.c (compressors): added back the
.xcf.gz and .xcf.bz2 extensions because they are the only way
to figure the special nature of this plug-in's extensions.
* app/widgets/gimpfileprocview.[ch]: keep a list of "meta
extensions" (extensions which have a '.' themselves).
* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
try to replace the whole extension if the last extension is one of
the meta extensions kept by GimpFileProcView. Fixes bug #158377.
2004-11-18 Sven Neumann <sven@gimp.org>
* plug-ins/maze/maze.[ch]
* plug-ins/maze/maze_face.c: removed the extra help button from
the Maze plug-in. Fixes bug #158605.
2004-11-18 Michael Natterer <mitch@gimp.org>
The following fixes have no visible effect because nobody
uses gimp_plugin_menu_register() on temp_procs yet:
* app/actions/plug-in-actions.[ch]: added
plug_in_actions_add_path() which just adds the actions needed for
a given menu math, but not the procedure action itself.
* app/gui/gui-vtable.c (gui_menus_create_entry): create the
menu_path's actions using above function so adding of submenus to
existing ui managers works.
* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register_invoker):
don't add a menu if "no_interface" is TRUE.
* app/pdb/plug_in_cmds.c: regenerated.
* plug-ins/script-fu/script-fu-scripts.c: pass untranslated
menu_paths to the core, not translated ones. Don't store the
scripts directly in the "script_list" tree but use a list of
scripts per key because there can be identical keys for different
scripts now. Fixed sorting of menu entries and menus.
2004-11-18 Simon Budig <simon@gimp.org>
* modules/controller_midi.c: implemented support for ALSA-midi,
currently disabled. Needs a configure-check and proper linking
against libasound.
2004-11-17 Dave Neary <bolsh@gimp.org>
* plug-ins/common/bumpmap.c: Fixed initialisation issue
that was crashing the plug-in on repeat runs. Fixes bug
#158494.
2004-11-17 Sven Neumann <sven@gimp.org>
* app/dialogs/print-size-dialog.c: added missing callbacks for the
size entries. Needs some more work though...
2004-11-17 Manish Singh <yosh@gimp.org>
* plug-ins/dbbrowser/Makefile.am: make libgimpprocbrowser a libtooled
library.
* plug-ins/dbbrowser/gimpprocbrowser.[ch]: add a user_data pointer
for GimpProcBrowserApplyCallback.
* plug-ins/dbbrowser/gimpprocbrowser.c: only convert the name to
scheme style if scheme_names in the proc info pane too.
* plug-ins/dbbrowser/procedure-browser.c
* plug-ins/script-fu/script-fu-console.c: pass NULL as user_data.
* plug-ins/script-fu/Makefile.am: reference libgimpprocbrowser.la.
* plug-ins/pygimp/Makefile.am
* plug-ins/pygimp/procbrowser.c: new module, which wraps
libgimprocbrowser.
* plug-ins/pygimp/gimpmodule.c
* plug-ins/pygimp/pygimp.h
* plug-ins/pygimp/pygimp-pdb.c: export GimpPDBFunction so other
modules can use it.
* plug-ins/pygimp/plug-ins/pdbbrowse.py
* plug-ins/pygimp/plug-ins/gimpcons.py: use gimpprocbrowser.
2004-11-17 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-interface.c: added a utility
function to reduce code duplication.
2004-11-17 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/script-fu-scripts.[ch]
* plug-ins/script-fu/siod-wrapper.c: appled patch from Kevin
Cozens which adds (script-fu-menu-register) and allows scripts to
register their menu_paths the same undeprecated way as plug-ins.
Fixes bug #158117.
* plug-ins/script-fu/scripts/test-sphere.scm: example how to use
the new API. Doesn't change strings because test-shpere.scm is an
untranslated example script.
2004-11-17 Michael Natterer <mitch@gimp.org>
Made plug-in menu registration work the same way for ordinary and
temporary procedures. Addresses bug #158117.
* app/core/gimp-gui.[ch]: added "const gchar *menu_path" to
gimp_menus_create_entry().
* app/gui/gui-vtable.c (gui_menus_create_entry): if menu_path is
NULL, behave as before and create an action and its menu entries
for all the procedure's menu_paths. If it is non-NULL, skip action
creation and create a menu entry just for that path.
* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add): call
gimp_menus_create_entry() with a NULL menu path and call it if
proc_def->menu_paths *or* proc_def->menu_label is non-NULL, so
it creates at least the procedure's action, even if it has
no menu_path (yet).
* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): check both
the list of procs and temp_procs when trying to register the
entry. Allow ordinary procedures and extensions to install stuff
at query() and init() time and allow temp_procs to install stuff
at any time.
* app/pdb/plug_in_cmds.c: regenerated.
2004-11-17 Michael Natterer <mitch@gimp.org>
* plug-ins/dbbrowser/gimpprocbox.c
* plug-ins/dbbrowser/gimpprocbrowser.[ch]
* plug-ins/dbbrowser/gimpprocview.c: some cleanup in preparation
of moving it to a more public place.
* plug-ins/dbbrowser/procedure-browser.c
* plug-ins/script-fu/script-fu-console.c: changed accordingly.
2004-11-17 Sven Neumann <sven@gimp.org>
* Makefile.am (DISTCHECK_CONFIGURE_FLAGS): removed --enable-gtk-doc
here since it only causes 'make distcheck' to break earlier as usual.
2004-11-17 Sven Neumann <sven@gimp.org>
* plug-ins/rcm/Makefile.am
* plug-ins/rcm/rcm_callback.c
* plug-ins/rcm/rcm_dialog.c
* plug-ins/rcm/rcm_stock.[ch]: applied a patch from Karine Proot
that replaces the XPM icons with stock icons (bug #140202).
* plug-ins/rcm/pixmaps/*.xpm: removed.
* plug-ins/Lighting/lighting_stock.c
* plug-ins/MapObject/mapobject_stock.c
* plug-ins/gfig/gfig-stock.c: fixed a common but harmless mistake
in the icon factory code.
2004-11-16 Manish Singh <yosh@gimp.org>
* app/widgets/gimpvectorstreeview.c: Hide SVG drop g_print under
be_verbose.
2004-11-16 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/gimpui.py: Handle placeholder defaults for gimp
objects (bug #158392). Patch by Joao S. O. Bueno.
2004-11-16 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/gimpui.py: Use img.name if filename is not
available (bug #158392). Patch by Joao S. O. Bueno.
2004-11-16 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/gimpfu.py
* plug-ins/pygimp/gimpui.py: Add a palette selector (bug #155325).
Patch by Joao S. O. Bueno.
2004-11-16 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/gimpfu.py: Fix -fu slider behavior (bug #155103).
Patch by Joao S. O. Bueno.
2004-11-16 Manish Singh <yosh@gimp.org>
* plug-ins/common/glasstile.c: Remove unnecessary G_OBJECT() casts.
2004-11-16 Manish Singh <yosh@gimp.org>
* configure.in:
* plug-ins/pygimp/Makefile.am: Compile pygimp with
-fno-strict-aliasing if the compiler supports it.
* plug-ins/pygimp/gimpui.py: Make "..." into "Browse..." for
everything but the filesel, for slightly more consistency with
script-fu. Addresses #124791.
* plug-ins/pygimp/gimpmodule.c: Wrapped
gimp_context_{get,set}_gradient and
gimp_gradient_get_{uniform,custom}_samples. Deprecated the deprecated
versions of these, and rewrote them in terms of the new functions.
2004-11-17 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in.c (plug_in_close): replaced the
while(plug_in->temp_procs) "loop" which called
plug_in_proc_frame_quit() by a real for()-loop iterating over the
list of PlugInProcFrames, calling g_main_loop_quit() on each main
loop. The old version did not unroll the stack but looped
infinitely. Spotted by Yosh.
2004-11-17 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_selection.c
* plug-ins/imagemap/imap_preferences.c: silent the compiler.
2004-11-17 Michael Natterer <mitch@gimp.org>
* plug-ins/common/jpeg.c: applied (modified) patch from S. Mukund
which adds EXIF thumbnail loading and saving.
Fixes bugs #155761 and #158190.
2004-11-16 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-arc.c
* plug-ins/gfig/gfig-bezier.c
* plug-ins/gfig/gfig-circle.c
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-ellipse.c
* plug-ins/gfig/gfig-line.c
* plug-ins/gfig/gfig-poly.c
* plug-ins/gfig/gfig-spiral.c
* plug-ins/gfig/gfig-star.c
* plug-ins/gfig/gfig-style.c
* plug-ins/gfig/gfig-style.h
* plug-ins/gfig/gfig-types.h
* plug-ins/gfig/gfig.h: added a toggle so we can now choose to stroke
the painting or not.
2004-11-16 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c: implemented the gradient fill, using a
shapeburst blend. This is very slow, but I dont see how it could be
done otherwise.
2004-11-16 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpfgbgeditor.c: get rid of the
gimp_fg_bg_editor_context_changed() callback and
g_signal_connect_swapped() gtk_widget_queue_draw() directly.
2004-11-16 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpchanneltreeview.c: implement
GimpDockedInterface::set_context() and set the context of the
embedded GimpComponentEditor. Fixes NULL-context crashes in
action callbacks when invoked from the component editor.
Spotted by Jimmac.
Unrelated:
* app/widgets/gimpitemtreeview.c: get rid of the
gimp_item_tree_view_context_changed() callback and
g_signal_connect_swapped() gimp_item_tree_view_set_image()
directly.
2004-11-16 Sven Neumann <sven@gimp.org>
* plug-ins/common/jigsaw.c: added missing braces around initializer.
2004-11-16 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/drawable_transform.pdb: renamed the new
drawable_foo_defaults() functions to drawable_foo_default() to be
consistent with paintbrush_default() and friends.
* tools/pdbgen/pdb/transform_tools.pdb
* libgimp/gimp.def: changed accordingly.
* app/pdb/drawable_transform_cmds.c
* app/pdb/transform_tools_cmds.c
* libgimp/gimpdrawabletransform_pdb.[ch]
* libgimp/gimptransformtools_pdb.c: regenerated.
* plug-ins/script-fu/scripts/coolmetal-logo.scm
* plug-ins/script-fu/scripts/image-structure.scm
* plug-ins/script-fu/scripts/text-circle.scm: follow the API change.
2004-11-16 Sven Neumann <sven@gimp.org>
* app/config/gimpbaseconfig.c: increased default tile-cache-size
to 128MB.
* app/config/gimpcoreconfig.c: increased default undo size to 16MB.
2004-11-16 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/image.pdb
* tools/pdbgen/pdb/selection.pdb: entirely removed the deprecated
functions "selection_clear", "image_set_cmap" and "image_get_cmap".
* app/pdb/procedural_db.c: and added them to the compat hash table
because they have undeprecated replacements with identical
signature.
* libgimp/gimpselection.[ch]: added gimp_selection_clear() here
instead because we need the symbol in libgimp.
* app/pdb/image_cmds.c
* app/pdb/internal_procs.c
* app/pdb/selection_cmds.c
* libgimp/gimpselection_pdb.[ch]: regenerated.
2004-11-16 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dobject.h: renamed the DObject type to
GfigObject, according to our common type naming. This type will
certainly become an abstract class in a near future.
* plug-ins/gfig/gfig-arc.c
* plug-ins/gfig/gfig-bezier.c
* plug-ins/gfig/gfig-bezier.h
* plug-ins/gfig/gfig-circle.c
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig-ellipse.c
* plug-ins/gfig/gfig-line.c
* plug-ins/gfig/gfig-line.h
* plug-ins/gfig/gfig-poly.c
* plug-ins/gfig/gfig-poly.h
* plug-ins/gfig/gfig-spiral.c
* plug-ins/gfig/gfig-star.c
* plug-ins/gfig/gfig-types.h
* plug-ins/gfig/gfig.c
* plug-ins/gfig/gfig.h: changed accordingly.
2004-11-16 Michael Natterer <mitch@gimp.org>
* app/core/gimpitem-linked.[ch] (gimp_item_linked_get_list):
removed redundant "gimage" parameter.
* app/tools/gimpeditselectiontool.c: changed accordingly.
2004-11-16 Michael Natterer <mitch@gimp.org>
* app/core/gimpchannel-select.c
* app/core/gimpchannel.c
* app/core/gimpdrawable-desaturate.c
* app/core/gimpdrawable-equalize.c
* app/core/gimpdrawable-histogram.c
* app/core/gimpdrawable-invert.c
* app/core/gimpdrawable-levels.c
* app/core/gimpdrawable-offset.c
* app/core/gimpdrawable-stroke.c
* app/core/gimpdrawable-transform.c
* app/core/gimpdrawable.c
* app/core/gimpitem-linked.c
* app/core/gimpitem.c
* app/core/gimplayer.c
* app/core/gimpselection.c
* app/paint/gimppaintcore-stroke.c
* app/text/gimptextlayer.c: in all functions which somehow
(explicitely or implicitely) touch undo, either g_return_if_fail()
on gimp_item_is_attached() or simply don't push an undo step if
feasible (e.g. for simple stuff like layer opacity).
* tools/pdbgen/pdb/color.pdb
* tools/pdbgen/pdb/drawable.pdb
* tools/pdbgen/pdb/image.pdb
* tools/pdbgen/pdb/layer.pdb
* tools/pdbgen/pdb/paint_tools.pdb: let PDB wrappers fail
accordingly so they don't run into the assertions added above.
* app/pdb/color_cmds.c
* app/pdb/drawable_cmds.c
* app/pdb/image_cmds.c
* app/pdb/layer_cmds.c
* app/pdb/paint_tools_cmds.c: regenerated.
2004-11-16 Sven Neumann <sven@gimp.org>
* app/actions/file-commands.c
* app/dialogs/file-save-dialog.c
* app/file/file-save.[ch]
* app/widgets/gimpfiledialog.[ch]: combined "set_uri_and_proc" and
"set_image_clean" parameters into a single "save_a_copy"
parameter. When saving a copy, attach the used URI to the image and
let the "Save a Copy" file chooser default to the last used value.
2004-11-16 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/glossy.scm: fixed typo (bug #158425).
2004-11-15 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig.c: added a blurb proposed by Alan Horkan.
* plug-ins/gfig/gfig-line.[ch]: smallish style fix.
2004-11-15 DindinX <dindinx@gimp.org>
* plug-ins/gfig/images/stock-ellipse.png: better icon for the ellipse
tool (a lot more elliptical) by Jimmac and Zigomar.
2004-11-15 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
limit the number of file extensions that are added to the file
filter menu to keep the file dialog from growing too wide.
2004-11-15 Philip Lafleur <plafleur@cvs.gnome.org>
* app/display/gimpdisplayshell-preview.c: Further optimization of
perspective tool preview - never calculate the same vertex more
than once.
2004-11-15 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfileprocview.c (gimp_file_proc_view_get_proc)
* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
better fix for bug #158369.
2004-11-15 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
return early if gimp_file_proc_view_get_proc() didn't return a file
procedure. Should fix bug #158369.
2004-11-15 Øyvind Kolås <pippin@gimp.org>
* docs/gimp.txt: removed, outdated.
* docs/make_todo: removed, unused.
2004-11-15 Sven Neumann <sven@gimp.org>
* app/dialogs/print-size-dialog.c: started to redo this dialog
without using a GimpSizeBox. The widgets aren't connected, so it
isn't usable yet.
* app/widgets/gimpprogressbox.c
* app/widgets/gimpprogressdialog.c
* app/widgets/gimpsizebox.c: trivial cleanups.
* data/images/gimp-splash.png: splash for 2.2-pre2, done by Jimmac.
2004-11-14 Sven Neumann <sven@gimp.org>
* app/actions/image-commands.c: converted error messages that should
never appear to warnings.
2004-11-14 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig-dobject.h: fixed a crash (the one triggered by
this sequence: draw a line, delete it, redraw something), and
corrected some ui spacing.
2004-11-14 Sven Neumann <sven@gimp.org>
* app/core/gimppalette-import.c: applied a (slightly modified)
patch from Nickolay V. Shmyrev that changes the palette import
function to not only read palettes in the RIFF format but also
GIMP and Photoshop ACT palette files (bug #158297).
2004-11-14 Sven Neumann <sven@gimp.org>
* Makefile.am (EXTRA_DIST)
* MAINTAINERS
* PLUGIN_MAINTAINERS
* TODO.xml: removed these files from the tarball and from CVS.
Doesn't make sense to keep unmaintained files around that provide
outdated and in large parts wrong information.
2004-11-14 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig-dialog.c (load_button_callback): use the
proper parent widget.
2004-11-14 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-types.h: small UI tweaks, suggested by Sven.
2004-11-14 Sven Neumann <sven@gimp.org>
* configure.in
* plug-ins/rcm/Makefile.am
* plug-ins/rcm/images/Makefile.am
* plug-ins/rcm/images/rcm-360.png
* plug-ins/rcm/images/rcm-a-b.png
* plug-ins/rcm/images/rcm-ccw.png
* plug-ins/rcm/images/rcm-cw.png: added PNG versions of the XPM
icons used by the RCM plug-in. Added rules to build a header file
that can be used to get rid of the XPM files (bug #140202).
2004-11-14 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-dialog.h
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig-dobject.h
* plug-ins/gfig/gfig-types.h
* plug-ins/gfig/gfig.c
* plug-ins/gfig/gfig.h: replace the crappy DAllObjs struct by a GList.
Makes the code cleaner and less error prone.
2004-11-14 Sven Neumann <sven@gimp.org>
* plug-ins/pagecurl/pagecurl.c: applied a patch from Karine Proot
that replaces the XPM icons with pixbufs (bug #140202).
* plug-ins/pagecurl/curl[0-7].xpm: removed.
2004-11-14 Sven Neumann <sven@gimp.org>
* plug-ins/gimpressionist/Makefile.am: fixed typo.
* plug-ins/pagecurl/Makefile.am
* plug-ins/pagecurl/curl[0-7].png: added PNG versions of the XPM
icons used by the PageCurl plug-in. Added rules to build a header
file that can be used to get rid of the XPM files (bug #140202).
2004-11-14 Philip Lafleur <plafleur@cvs.gnome.org>
* app/display/gimpdisplayshell-preview.c: Eliminated about 396
floating-point divides per frame in the persective preview.
2004-11-13 Manish Singh <yosh@gimp.org>
Fix a bunch of warnings from Sparse:
* app/actions/dockable-commands.c
* app/actions/layers-actions.c
* app/actions/view-commands.c
* app/base/pixel-surround.c
* app/config/gimpconfig-utils.c
* app/config/gimpscanner.c
* app/core/gimpbrushgenerated.c
* app/core/gimpcontainer.c
* app/core/gimpimage.c
* app/dialogs/palette-import-dialog.c
* app/file/gimprecentlist.c
* app/plug-in/plug-in-params.c
* app/text/gimptext-compat.c
* app/text/gimptext-parasite.c
* app/vectors/gimpbezierstroke.c
* app/vectors/gimpstroke.c
* app/widgets/gimpcellrendereraccel.c
* app/widgets/gimpselectiondata.c
* app/xcf/xcf.c
* libgimp/gimp.c
* libgimpthumb/gimpthumb-utils.c
* libgimpthumb/gimpthumbnail.c
* modules/cdisplay_proof.c
* plug-ins/Lighting/lighting_ui.c
* plug-ins/common/csource.c
* plug-ins/common/glasstile.c
* plug-ins/common/nova.c
* plug-ins/common/pcx.c
* plug-ins/common/pnm.c
* plug-ins/common/randomize.c
* plug-ins/common/screenshot.c
* plug-ins/common/sel_gauss.c
* plug-ins/common/spheredesigner.c
* plug-ins/common/wind.c
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gimpressionist/gimpressionist.c
* plug-ins/ifscompose/ifscompose.c
* plug-ins/print/gimp_main_window.c
* plug-ins/print/print.c: Cleanup integer vs. pointer confusion.
* app/base/temp-buf.c
* app/dialogs/about-dialog.c
* plug-ins/common/bumpmap.c
* plug-ins/common/jigsaw.c
* plug-ins/gfig/gfig-dobject.c: Cosmetic cleanups.
* app/config/gimpconfig-deserialize.c
* app/config/gimpconfig-path.c
* app/config/gimpconfigwriter.c
* app/core/gimpgradient.c
* app/tools/gimpdrawtool.c
* plug-ins/common/nlfilt.c
* plug-ins/common/unsharp.c
* plug-ins/common/zealouscrop.c: Define inline functions before they
are used.
* app/core/gimpdrawable-blend.c: PixelRegion definition was changed
some time ago, but the initialization here didn't change. Fix it.
* app/plug-in/plug-in-rc.c (plug_in_extra_deserialize): No need to
assign token twice in a row.
* libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories): No
need to initialize file_data, since the code fills out all the fields.
* plug-ins/common/CML_explorer.c
* plug-ins/common/vpropagate.c: Declare function pointers fully.
* plug-ins/common/grid.c (pix_composite): G_INLINE_FUNC isn't needed,
we assume we can use the "inline" keyword always.
* plug-ins/common/psd_save.c
* plug-ins/common/vinvert.c
* plug-ins/gfig/gfig-arc.c
* plug-ins/gfig/gfig-bezier.c
* plug-ins/gfig/gfig-circle.c
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig-ellipse.c
* plug-ins/gfig/gfig-line.c
* plug-ins/gfig/gfig-poly.c
* plug-ins/gfig/gfig-spiral.c
* plug-ins/gfig/gfig-star.c
* plug-ins/gfig/gfig.c
* plug-ins/gimpressionist/orientmap.c
* plug-ins/gimpressionist/placement.c
* plug-ins/gimpressionist/sizemap.c
* plug-ins/imagemap/imap_grid.c
* plug-ins/imagemap/imap_main.c
* plug-ins/imagemap/imap_preferences.c
* plug-ins/imagemap/imap_settings.c
* plug-ins/maze/maze.c
* plug-ins/sel2path/curve.c
* plug-ins/sel2path/fit.c
* plug-ins/sel2path/pxl-outline.c
* plug-ins/sel2path/spline.c
* plug-ins/xjt/xjt.c: Functions with no args should be declared
with (void).
* plug-ins/common/retinex.c (MSRCR): Initialize max_preview to quiet
the compiler.
2004-11-14 Sven Neumann <sven@gimp.org>
* themes/Default/images/Makefile.am
* themes/Default/images/stock-center-16.png
* themes/Default/images/stock-center-24.png
* themes/Default/images/stock-print-resolution-16.png
* themes/Default/images/stock-print-resolution-24.png: new icons
drawn by Jimmac.
* libgimpwidgets/gimpstock.[ch]: registered the new icons.
* app/actions/image-actions.c
* app/dialogs/print-size-dialog.c
* app/dialogs/resize-dialog.c
* plug-ins/ifscompose/ifscompose.c: use them.
2004-11-14 Sven Neumann <sven@gimp.org>
* configure.in: bumped version to 2.2-pre2.
2004-11-13 Manish Singh <yosh@gimp.org>
* tools/pdbgen/pdb/image.pdb: Adapted Sven's code into pdbgen so
that gimp_image_set_filename() validates that it is called with
a filename in the filesystem encoding which can safely be converted
to UTF-8 and back. Fixes #153751.
* app/pdb/image_cmds.c
* libgimp/gimpimage_pdb.c: Regenerated.
2004-11-13 Sven Neumann <sven@gimp.org>
* app/dialogs/Makefile.am
* app/dialogs/print-size-dialog.[ch]: new files for the Print Size
dialog that was missing. Still work in progress...
* app/actions/image-actions.c
* app/actions/image-commands.[ch]
* app/widgets/gimphelp-ids.h
* menus/image-menu.xml.in: integrate the new dialog.
2004-11-13 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/selection.pdb: deprecate gimp_selection_clear()
in favor of gimp_selection_none(). Fixes bug #156765.
* app/pdb/selection_cmds.c
* libgimp/gimpselection_pdb.[ch]: regenerated.
2004-11-13 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/gfig/gfig.c
* plug-ins/gfig/gfig-dialog.c: Changed gimp_selection_clear() to
gimp_selection_none() (bug #156765).
2004-11-13 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/gimp-headers.scm
* plug-ins/script-fu/scripts/gimp-labels.scm
* plug-ins/script-fu/scripts/news-text.scm
* plug-ins/script-fu/scripts/speed-text.scm: Changed calls to
gimp-selection-clear to use gimp-selection-none in preparation
for the deprecation of -clear. (bug #156765)
2004-11-13 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/image.pdb: document the fact that
gimp_image_get_filename() returns the filename in the filesystem
encoding. Fixed gimp_image_get_name() to actually return the name
in UTF-8 encoding.
* app/pdb/image_cmds.c
* libgimp/gimpimage_pdb.c: Regenerated.
* app/vectors/gimpbezierstroke.h: formatting.
2004-11-13 Sven Neumann <sven@gimp.org>
* app/core/gimpimagefile.[ch]
* app/file/file-open.c
* app/file/file-save.c: pass the MIME type from the save procedure
to gimp_imagefile_save_thumbnail() so that it can be stored with
the thumbnail.
* tools/pdbgen/pdb/fileops.pdb
* app/pdb/fileops_cmds.c: changed accordingly.
2004-11-13 Sven Neumann <sven@gimp.org>
* app/plug-in/plug-in-proc-def.[ch]
* app/plug-in/plug-in-rc.c
* app/plug-in/plug-ins.[ch]: allow to associate a procedure for
thumbnail loading with any file load procedure.
* tools/pdbgen/pdb/fileops.pdb: export this functionality to the
PDB as gimp_register_thumbnail_loader().
* app/pdb/fileops_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpfileops_pdb.[ch]: regenerated.
* app/core/gimpimagefile.c
* app/file/file-open.[ch]: when creating a thumbnail for an image
file, use a thumbnail load procedure if available.
* plug-ins/common/svg.c: added "file_svg_load_thumb", a procedure
that allows to load a small preview of the SVG image.
2004-11-13 DindinX <dindinx@gimp.org>
* app/actions/layers-actions.c: added back <control>H as a shortcut
for "Anchor Layer". Spotted by Bruno Ronzani.
2004-11-13 DindinX <dindinx@gimp.org>
* plug-ins/common/retinex.c: use a GimpAspectPreview instead of a
GimpDrawablePreview. Fixes bug #157915. Also fixed the funny behaviour
of the progress bar.
2004-11-13 Sven Neumann <sven@gimp.org>
* libgimpbase/gimputils.c (gimp_strip_uline): changed based on a
patch by Joao S. O. Bueno to remove mnemonics as used in languages
like Chinese. Fixes bug #157561.
2004-11-13 Sven Neumann <sven@gimp.org>
* plug-ins/ifscompose/README.ifscompose: updated link to the
tutorial (pointed out by Alan Horkan) and added another link.
* plug-ins/ifscompose/ifscompose.c: changed plug-in name from
"IfsCompose" to "IFS Fractal". Sorry for the late string changes
but the old name definitely was akward and probably hard to
translate anyway. Fixes bug #157135.
* plug-ins/ifscompose/ifscompose_storage.c: removed trailing
whitespace.
2004-11-13 Sven Neumann <sven@gimp.org>
* plug-ins/common/retinex.c (retinex_dialog): fixed table size.
2004-11-13 Simon Budig <simon@gimp.org>
* app/core/gimpimage-merge.c: Return the active layer instead of
the bottom layer when just merging down a floating selection.
Untabbified.
Fixes bug #158130.
2004-11-12 Sven Neumann <sven@gimp.org>
* app/config/gimpconfig-dump.c: better fix for bug #157971.
* docs/gimprc.5.in: regenerated.
2004-11-12 DindinX <dindinx@gimp.org>
* plug-ins/gfig/images/stock-show-all.png
* plug-ins/gfig/images/stock-select-object.png: new icons made by
Jimmac.
2004-11-12 Michael Natterer <mitch@gimp.org>
* app/core/gimpimage-undo-push.c: disallow non-attached items
to be pushed to the undo stack.
2004-11-12 DindinX <dindinx@gimp.org>
* plug-ins/gfig/images/stock-show-all.png
* plug-ins/gfig/images/stock-select-object.png: added these two stock
icons. Jimmac, these two are screaming to be redone, please.
* plug-ins/gfig/images/Makefile.am: added these icons.
* plug-ins/gfig/gfig-bezier.c
* plug-ins/gfig/gfig-bezier.h
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-poly.c
* plug-ins/gfig/gfig-poly.h
* plug-ins/gfig/gfig-spiral.c
* plug-ins/gfig/gfig-spiral.h
* plug-ins/gfig/gfig-star.c
* plug-ins/gfig/gfig-star.h
* plug-ins/gfig/gfig-stock.c
* plug-ins/gfig/gfig-stock.h
* plug-ins/gfig/gfig.h: moved all the buttons to a GtkUIManager
toolbar, which makes the code simpler and easier to read.
2004-11-12 Sven Neumann <sven@gimp.org>
* app/dialogs/tips-dialog.c: added icons to the Previous/Next
buttons (bug #158004).
2004-11-11 Sven Neumann <sven@gimp.org>
* app/gui/splash.c: lowered labels a few pixels.
2004-11-11 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig-dialog.c: minor code cleanup.
2004-11-11 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c: use a GtkUIManager for the menu and
automagically have it translated! The button bar will follow the same
path. Remove the now useless "Paint" button.
2004-11-11 Sven Neumann <sven@gimp.org>
* app/config/gimpconfig-dump.c: groff doesn't like lines to start
with a single quote, we better escape it. Fixes bug #157971.
* docs/gimprc.5.in: regenerated.
2004-11-11 Michael Natterer <mitch@gimp.org>
* app/core/gimp-edit.c
* app/core/gimpdrawable-blend.c
* app/core/gimpdrawable-bucket-fill.c
* app/core/gimpitem.c (gimp_item_stroke): added precondition
checks for gimp_item_is_attached() and removed checks for
gimp_item_get_image() to actually return an image (because it
always returns an image).
* tools/pdbgen/pdb/edit.pdb: let all wrappers fail if the drawable
is not attached.
* app/pdb/edit_cmds.c: regenerated.
2004-11-11 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/scripts/add-bevel.scm
* plug-ins/script-fu/scripts/addborder.scm
* plug-ins/script-fu/scripts/carve-it.scm
* plug-ins/script-fu/scripts/carved-logo.scm
* plug-ins/script-fu/scripts/chip-away.scm
* plug-ins/script-fu/scripts/clothify.scm
* plug-ins/script-fu/scripts/font-map.scm
* plug-ins/script-fu/scripts/slide.scm
* plug-ins/script-fu/scripts/swirltile.scm: don't call gimp-edit-*
functions on drawables which are not added to an image because
this will be forbidden soon (because it can trash the image's undo
stack).
2004-11-11 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/scripts/lava.scm: replaced
undo-disable/enable by undo-group-start/end.
2004-11-11 Michael Natterer <mitch@gimp.org>
* app/tools/gimpimagemaptool.c (gimp_image_map_tool_response):
call gimp_image_flush() after committing the image_map so the
menus are up-to-date. Fixes bug #157914.
2004-11-11 Philip Lafleur <plafleur@cvs.gnome.org>
* app/display/gimpdisplayshell-preview.c: Use the transform
tool coordinates when creating subdivisions, not the
texture coordinates. Fixes breakage with layers that are not
the image size.
2004-11-11 Jay Cox <jaycox@gimp.org>
* app/base/brush-scale.c: Keep computed brush values from
overflowing with large reduction factors. Fixes bug #76228.
2004-11-11 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpintstore.c
* app/vectors/gimpvectors-import.c: please the overly pedantic
IRIX MIPSpro compiler and don't initialize structs with
non-constant values.
2004-11-10 Sven Neumann <sven@gimp.org>
* app/file/file-open.c (file_open_layer): add the image to the
list of recently used documents. Fixes bug #157879.
2004-11-10 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c: moved the tool options closer to the
tools and made the dialog a bit smaller.
2004-11-10 Sven Neumann <sven@gimp.org>
* plug-ins/common/mail.c: added a menu icon (compiled-in).
2004-11-10 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell-handlers.c
(gimp_display_shell_resolution_changed_handler): if dot_for_dot is
off, resolution change has the same effect as size change, so call
gimp_display_shell_size_changed_handler(). Fixes display garbage.
2004-11-10 Michael Natterer <mitch@gimp.org>
* plug-ins/winicon/icodialog.[ch]
* plug-ins/winicon/icoload.[ch]
* plug-ins/winicon/icosave.[ch]
* plug-ins/winicon/main.[ch]: call progress functions
unconditionally; removed global "interactive" variable; use
standard strings for open/save progress messages; gui, indentation
& coding style cleanup; untabified.
2004-11-10 Michael Schumacher <schumaml@cvs.gnome.org>
* plug-ins/winsnap/winsnap.c: applied a patch from Sven Neumann
with some minor modifications. Fixes bug #157612
Removed some unused variables.
2004-11-10 Michael Natterer <mitch@gimp.org>
* libgimpbase/gimputils.c (gimp_escape_uline): "Since: GIMP 2.2".
2004-11-10 Sven Neumann <sven@gimp.org>
* app/dialogs/preferences-dialog.c: set the padding-mode to custom
color if a custom color is choosen. Fixes bug #157844.
2004-11-10 Michael Natterer <mitch@gimp.org>
* plug-ins/dbbrowser/plugin-browser.c (browser_dialog_new): fixed
capitalization of notebook tab label.
2004-11-10 Michael Natterer <mitch@gimp.org>
* libgimpbase/gimputils.[ch]: renamed gimp_flags_get_value() to
gimp_flags_get_first_value(). Reordered functions so enum and
flags functions are grouped together. Added missing docs.
* libgimpbase/gimpbase.def: changed accordingly.
2004-11-09 Jay Cox <jaycox@gimp.org>
* plug-ins/common/psd.c: Skip resources with unknown signatures
instead of quiting. Fixes bug #142468, and bug #152728
* app/core/gimpdrawable.c: in functions gimp_drawable_mask_bounds,
and gimp_drawable_mask_intersect: reinitialize the return values
after calling gimp_channel_bounds because gimp_channel_bounds
overwrites the values even when it returns false. This fixes the
bug where the gimp crashes when running color tools on layers
smaller than the image, and processes only part of the image when
the layer is larger than the image size.
2004-11-10 Sven Neumann <sven@gimp.org>
* HACKING: some updates.
2004-11-10 Michael Natterer <mitch@gimp.org>
* plug-ins/ifscompose/ifscompose.c: use a UI manager created
toolbar instead of two rows of buttons. Added a "dummy-menubar" so
the popup menu shows shortcuts again. Removed "Preview" and "Auto"
buttons since the preview doesn't block the GUI and can always be
updated.
2004-11-10 Michael Natterer <mitch@gimp.org>
* app/display/gimpstatusbar.[ch]: added new function
gimp_statusbar_push_length(), which works exactly like
push_coords() but takes only one value plus a GimpOrientationType
for specifying the value's axis.
* app/tools/gimptool.[ch]: added the corresponding
gimp_tool_push_status_length().
* app/tools/gimpmovetool.c: use gimp_tool_push_status_length()
so the guide position is shown in the selected display unit.
Cleaned up the status message code a bit.
2004-11-10 Sven Neumann <sven@gimp.org>
* plug-ins/helpbrowser/dialog.c: use an idle handler to jump to the
anchor.
2004-11-09 Manish Singh <yosh@gimp.org>
* plug-ins/common/bmpread.c: if the file has space in the colormap for
more than 256 entries, ignore them instead of failing. Fixes bug
#157775.
2004-11-09 Manish Singh <yosh@gimp.org>
* plug-ins/common/bmpread.c: Fix cut'n'paste err so grayscale images
load again. Fixes bug #157764.
2004-11-09 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell-callbacks.c
(gimp_display_shell_canvas_tool_events): pass (gint)-truncated
coordinates instead of RINT()-rounded ones to
gimp_display_shell_update_cursor(). Restores correct coordinates
display for zoomed-in display and fixes bug #153534.
* app/tools/gimpmovetool.c: added statusbar messages including the
(rounded) guide coordinate. Keeps bug #141719 closed.
2004-11-09 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell.c (gimp_display_shell_new): don't
connect to "event" and don't connect any canvas event to
gimp_display_shell_events(). Connect all tool events separately
(doesn't include "configure-event" and thus fixes bug #141543).
* app/display/gimpdisplayshell-callbacks.c
(gimp_display_shell_canvas_tool_events): call
gimp_display_shell_events() manually before doing tool event
processing.
* app/display/gimpdisplayshell.c
* app/display/gimpdisplayshell-callbacks.[ch]: connect to
"size_allocate" of the canvas, not to "configure_event"
(suggested by Owen in bug #141543).
* app/display/gimpdisplayshell-callbacks.[ch]: removed
gimp_display_shell_popup_menu().
(gimp_display_shell_origin_button_press): emit "popup-menu" on the
shell manually instead of calling above function.
* app/display/gimpdisplayshell.c: added the whole menu popup code
here.
2004-11-09 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpoffsetarea.c (gimp_offset_area_resize): queue
a resize. Fixes remaining issues with bug #157495.
2004-11-09 Sven Neumann <sven@gimp.org>
* plug-ins/common/url.c: removed debug output.
2004-11-08 Sven Neumann <sven@gimp.org>
* app/dialogs/user-install-dialog.c (user_install_migrate_files):
don't copy menurc, the format changed anyway.
2004-11-08 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-interface.c (script_fu_ok):
actually retrieve the value from the GtkEntry for SF-VALUE.
2004-11-08 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/layer.pdb: applied modified patch from Geert
Jordaens which adds the missing gimp_layer_from_mask() API.
Addresses bug #138662.
* app/pdb/internal_procs.c
* app/pdb/layer_cmds.c
* libgimp/gimplayer_pdb.[ch]. regenerated.
* libgimp/gimp.def: changed accordingly.
2004-11-08 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/scripts/selection-round.scm: removed garbage
from beginning of file. Removed DOS line breaks.
2004-11-08 Michael Natterer <mitch@gimp.org>
* libgimp/gimppixelfetcher.c: added docs derived from a patch from
Cai Qian (bug #156271).
2004-11-08 Sven Neumann <sven@gimp.org>
* plug-ins/common/screenshot.c: changed label of default action
button to "Grab".
2004-11-08 Sven Neumann <sven@gimp.org>
* plug-ins/common/CEL.c
* plug-ins/common/CML_explorer.c
* plug-ins/common/channel_mixer.c
* plug-ins/common/gqbist.c
* plug-ins/common/spheredesigner.c
* plug-ins/flame/flame.c
* plug-ins/ifscompose/ifscompose.c: don't set help-ids on plug-in
file chooser dialogs. Set the default response for file dialogs.
2004-11-08 Michael Natterer <mitch@gimp.org>
* app/dialogs/resize-dialog.c (resize_dialog_response)
* app/dialogs/scale-dialog.c (scale_dialog_response): replaced
"case GTK_RESPONSE_CANCEL:" by "default:" so it also catches
hitting the escape key or clicking the WM close button.
2004-11-08 Øyvind Kolås <pippin@gimp.org>
* plug-ins/common/gqbist.c: fixed typo in construction of file
chooser, use gtk_dialog_run instead of separate callbacks for
the responses of the file chooser dialog.
2004-11-08 Sven Neumann <sven@gimp.org>
* app/core/gimpdrawable.c (gimp_drawable_mask_bounds)
(gimp_drawable_mask_intersect): initialize the return values before
checking if the drawable is attached. Keeps GIMP from going mad if
this assertion is ever triggered.
2004-11-07 Sven Neumann <sven@gimp.org>
* plug-ins/helpbrowser/dialog.c: don't connect the help browser to
the help system.
2004-11-07 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/selection-round.scm: register the
compatibility procedure with the correct name.
2004-11-07 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpcolorbutton.c: fixed unused code (tooltip was
taken from label field).
2004-11-07 Sven Neumann <sven@gimp.org>
* plug-ins/ifscompose/ifscompose.c: ported to GtkUIManager.
2004-11-07 Sigurd Gartmann <sigurd-translate@brogar.org>
* configure.in: Added support for the new locale nb to ALL_LINGUAS.
2004-11-07 Sven Neumann <sven@gimp.org>
* plug-ins/common/channel_mixer.c (query): the menu label should
have three dots (bug #157580).
2004-11-07 DindinX <dindinx@gimp.org>
* plug-ins/gflare/gflare.c: removed #undef GTK_DISABLE_DEPRECATED and
use a GtkListStore instead of the long-time deprecated GtkList. Done
some small cleanups, too.
2004-11-06 Sven Neumann <sven@gimp.org>
* app/core/gimpbrushgenerated.c: changed minimum brush radius from
1.0 to 0.1.
* app/widgets/gimpbrusheditor.c: allow a smaller brush radius to
be set in the brush editor. Fixes bug #157508.
2004-11-06 Sven Neumann <sven@gimp.org>
* app/dialogs/scale-dialog.c (scale_dialog_reset): same fix here.
2004-11-06 Sven Neumann <sven@gimp.org>
* app/dialogs/preferences-dialog.c: fixed typo (bug #157513).
2004-11-06 Sven Neumann <sven@gimp.org>
* app/dialogs/convert-dialog.c (convert_dialog_new): removed
trailing period from check button label. Fixes bug #157511.
2004-11-06 Sven Neumann <sven@gimp.org>
* app/dialogs/resize-dialog.c (resize_dialog_reset): fixed most of
the Reset functionality (bug #157495). The offset box is still not
working correctly.
* app/widgets/gimpsizebox.c (gimp_size_box_update_resolution):
check for availability of the size entry before accessing it.
2004-11-06 Sven Neumann <sven@gimp.org>
New Win32 icons contributed by Jernej Simoncic:
* app/Makefile.am
* app/makefile.msc
* app/gimp.rc
* app/fileicon.ico: added new file icon for the Win32 build.
* app/wilber.ico: nicer application icon for the Win32 build.
2004-11-05 Michael Natterer <mitch@gimp.org>
* plug-ins/maze/maze.c
* plug-ins/maze/maze_face.c: some irrelevant cleanups while doing
code review.
2004-11-05 Michael Natterer <mitch@gimp.org>
* plug-ins/flame/flame.c: removed #undef GTK_DISABLE_DEPRECATED
because it's no longer needed. Cleaned up #defines and
declarations. Removed tabs and trailing whitespace.
2004-11-04 Sven Neumann <sven@gimp.org>
* app/widgets/gimpsessioninfo.c: be more tolerant and silently
skip entries that the dialog factory doesn't recognize.
* app/widgets/gimpdialogfactory.c: minor cleanup.
2004-11-04 Sven Neumann <sven@gimp.org>
* app/dialogs/user-install-dialog.c (user_install_response): don't
save the (empty) gimprc after migrating the user settings.
2004-11-04 Michael Natterer <mitch@gimp.org>
* plug-ins/common/uniteditor.c: undeprecated by using a
GtkUIManager for creating the toolbar. Some cleanup and code
reordering.
2004-11-04 Michael Natterer <mitch@gimp.org>
* configure.in: disable the whole bunch of FOO_DISABLE_DEPRECATED
only for future versions of GLib, GTK+ and Pango because the
upcoming new stable versions add no new deprecations that are
relevant for the GIMP source.
2004-11-04 Michael Natterer <mitch@gimp.org>
* plug-ins/ifscompose/ifscompose.c: some undeprecation and
cleanup. Still uses GtkItemFactory.
2004-11-04 Michael Natterer <mitch@gimp.org>
Don't use deprecated GtkToolbar API in GimpTextEditor:
* app/actions/Makefile.am
* app/actions/actions.c
* app/actions/text-editor-actions.[ch]
* app/actions/text-editor-commands.[ch]: added acions and
callbacks for the new "text-editor" action group.
* app/menus/menus.c: register a "<TextEditor>" UI manager.
* menus/Makefile.am
* menus/text-editor-toolbar.xml: new file for the toolbar.
* app/widgets/gimptexteditor.[ch]: use the toolbar created by the
UI manager instead of constructing it using deprecated API.
* app/tools/gimptextoptions.c: changed accordingly.
* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_load()
(used by text-editor-commands.c).
2004-11-04 Michael Natterer <mitch@gimp.org>
* plug-ins/ifscompose/ifscompose.c: #undef GTK_DISABLE_DEPRECATED.
2004-11-04 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcolorbutton.[ch]: use a GtkUIManager instead
of a GtkItemFactory. Added virtual function ::get_action_type()
and create the manager's actions manually using that action type
instead of using gtk_action_group_add_actions().
* app/widgets/gimpcolorpanel.c: override ::get_action_type() so it
creates GimpActions (which can have a color attached) instead of
GtkActions. Changed the menu item visibility and color preview
code accordingly.
* app/widgets/Makefile.am
* app/widgets/gimpitemfactory.[ch]: finally removed.
* configure.in: added -DGTK_DISABLE_DEPRECATED to CPPFLAGS again.
2004-11-04 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpoldwidgets.c: #undef GTK_DISABLE_DEPRECATED
* libgimpwidgets/gimpunitmenu.h: #include <gtk/gtkoptionmenu.h>
explicitely and #undef GTK_DISABLE_DEPRECATED only around the
inclusion if it was defined before.
2004-11-04 Michael Natterer <mitch@gimp.org>
* libgimp/gimpunitcache.h
* libgimpbase/gimpchecks.h
* libgimpbase/gimpdatafiles.h
* libgimpbase/gimplimits.h
* libgimpbase/gimpmemsize.h
* libgimpbase/gimputils.h
* libgimpbase/gimpwin32-io.h
* libgimpthumb/gimpthumb-enums.h
* libgimpthumb/gimpthumb-error.h
* libgimpwidgets/gimppreviewarea.h: added G_BEGIN_DECLS / G_END_DECLS.
2004-11-04 Michael Natterer <mitch@gimp.org>
* plug-ins/common/ccanalyze.c
* plug-ins/common/uniteditor.c
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-preview.c
* plug-ins/ifscompose/ifscompose.c
* plug-ins/imagemap/imap_misc.c
* plug-ins/imagemap/imap_selection.c
* plug-ins/imagemap/imap_toolbar.c
* plug-ins/imagemap/imap_tools.c
* plug-ins/print/gimp_color_window.c: stop using deprecated
functions, added some #undef GTK_DISABLE_DEPRECATED where needed.
2004-11-03 Michael Natterer <mitch@gimp.org>
* app/dialogs/module-dialog.c
* plug-ins/dbbrowser/gimpprocbrowser.c
* plug-ins/dbbrowser/plugin-browser.c: use
gtk_tree_model_get_iter_first() instead of the deprecated
_get_iter_root().
* app/display/gimpdisplayshell-callbacks.c: don't include
"widgets/gimpitemfactory.h".
2004-11-03 Øyvind Kolås <pippin@gimp.org>
* app/base/gimphistogram.h: %s/historgam/histogram/
2004-11-03 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdasheditor.c (gimp_dash_editor_finalize): don't
forget to g_free(editor->segments).
2004-11-03 Michael Natterer <mitch@gimp.org>
* app/display/gimpscalecombobox.c
(gimp_scale_combo_box_mru_remove_last)
* app/widgets/gimpeditor.c (gimp_editor_add_action_button)
* app/xcf/xcf-load.c (xcf_load_old_path): plugged some small leaks.
2004-11-03 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
plugged a mem-leak.
* app/widgets/gimpviewrendererimagefile.c
(gimp_view_renderer_imagefile_render): don't leak the pixbuf here.
* app/widgets/gimpviewrenderer-frame.c: added a comment.
2004-11-03 Michael Natterer <mitch@gimp.org>
* app/paint-funcs/paint-funcs.c (combine_sub_region): applied
patch from Joao S. O. Bueno which moves assignments into an "else"
branch and thus optimizes the (common) "if" branch. Did some
cosmetic cleanups.
2004-11-02 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
don't silently return when there is already a script running but
show a message instead. Unfortunately introduces two new strings,
but bugs are bugs. Fixes bug #123882.
2004-11-02 Sven Neumann <sven@gimp.org>
* app/core/gimpimagefile.c (gimp_imagefile_save_thumb): minor
cleanup.
* libgimpthumb/gimpthumb-utils.c (_gimp_thumbs_delete_others): do
the right thing. Used to do the wrong thing when called with a
thumbnail size which is not from the GimpThumbSize enum.
2004-11-02 Sven Neumann <sven@gimp.org>
* app/actions/image-commands.c (image_new_from_image_cmd_callback):
call image_new_dialog_set() unconditionally. Fixes bug #157096.
2004-11-02 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/drawable_transform.pdb: factored out the
"invoke" bodies to two utility functions, getting rid of *tons* of
duplicated code.
* app/pdb/drawable_transform_cmds.c: regenerated (only whitespace
and comments changed).
2004-11-02 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/drawable_transform.pdb (drawable_*_defaults):
renamed parameter "interpolation" to "interpolate" as suggested by
pippin.
* app/pdb/drawable_transform_cmds.c
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
2004-11-02 Michael Natterer <mitch@gimp.org>
* app/dialogs/user-install-dialog.c (user_install_migrate_files):
don't copy pluginrc* and themerc*.
2004-11-02 Michael Natterer <mitch@gimp.org>
* libgimp/gimpimage.h: one more s/cmap/colormap/.
2004-11-02 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/transform_tools.pdb: deprecated all functions.
* app/pdb/transform_tools_cmds.c
* libgimp/gimptransformtools_pdb.[ch]: regenerated.
* plug-ins/common/tiff.c
* plug-ins/script-fu/scripts/3dTruchet.scm
* plug-ins/script-fu/scripts/coolmetal-logo.scm
* plug-ins/script-fu/scripts/image-structure.scm
* plug-ins/script-fu/scripts/perspective-shadow.scm
* plug-ins/script-fu/scripts/text-circle.scm
* plug-ins/script-fu/scripts/truchet.scm: use the new transform API.
2004-11-02 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/drawable_transform.pdb: added _defaults()
variants (flip_defaults, rotate_defaults, ...) for all transform
functions which finally call gimp_drawable_transform_affine().
The _defaults() functions don't take the whole interpolation_type,
supersample etc. parameter overkill, but only a "interpolation"
boolean like the old PDB wrappers.
* libgimp/gimp.def: changed accordingly.
* app/pdb/drawable_transform_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
2004-11-02 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/drawable_transform.pdb: renamed flip() and
rotate() to flip_simple() and rotate_simple(). Renamed flip_free()
and rotate_free() to flip() and rotate() (the special cases should
have a special suffix, not the general ones).
* libgimp/gimp.def: changed accordingly.
* app/pdb/drawable_transform_cmds.c
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
2004-11-02 Michael Natterer <mitch@gimp.org>
* plug-ins/common/compressor.c (compressors): added missing bzip2
command lines for Win32.
2004-11-02 Michael Natterer <mitch@gimp.org>
* plug-ins/bmp/bmpread.c
* plug-ins/bmp/bmpwrite.c
* plug-ins/common/CEL.c
* plug-ins/common/animationplay.c
* plug-ins/common/animoptimize.c
* plug-ins/common/autostretch_hsv.c
* plug-ins/common/c_astretch.c
* plug-ins/common/ccanalyze.c
* plug-ins/common/color_enhance.c
* plug-ins/common/film.c
* plug-ins/common/gee.c
* plug-ins/common/gee_zoom.c
* plug-ins/common/gif.c
* plug-ins/common/gifload.c
* plug-ins/common/grid.c
* plug-ins/common/header.c
* plug-ins/common/mng.c
* plug-ins/common/normalize.c
* plug-ins/common/pcx.c
* plug-ins/common/png.c
* plug-ins/common/pnm.c
* plug-ins/common/postscript.c
* plug-ins/common/psd.c
* plug-ins/common/psd_save.c
* plug-ins/common/raw.c
* plug-ins/common/sunras.c
* plug-ins/common/tga.c
* plug-ins/common/tiff.c
* plug-ins/common/tile.c
* plug-ins/common/vinvert.c
* plug-ins/common/winclipboard.c
* plug-ins/common/winprint.c
* plug-ins/common/xbm.c
* plug-ins/common/xpm.c
* plug-ins/common/xwd.c
* plug-ins/fits/fits.c
* plug-ins/gfli/gfli.c
* plug-ins/imagemap/imap_preview.c
* plug-ins/print/print.c
* plug-ins/pygimp/pygimp-image.c
* plug-ins/winicon/main.c: use the new "colormap" functions
instead of the deprecated "cmap" ones.
2004-11-02 Michael Natterer <mitch@gimp.org>
More final API cleanup:
* tools/pdbgen/pdb/image.pdb: added gimp_image_set,get_colormap()
and deprecated set,get_cmap().
* libgimpwidgets/gimppreviewarea.[ch]: renamed
gimp_preview_area_set_cmap() to set_colormap().
* libgimp/gimp.def
* libgimp/gimpdrawablepreview.c
* libgimp/gimpexport.c
* libgimp/gimpimage.[ch]
* libgimpwidgets/gimpwidgets.def: changed accordingly.
* app/pdb/image_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpimage_pdb.[ch]: regenerated.
(undeprecation of plug-ins will follow...)
2004-11-02 Michael Natterer <mitch@gimp.org>
* app/tools/gimpcroptool.c (crop_recalc): added "gboolean
recalc_highlight" and call gimp_display_shell_set_highlight() only
when it's TRUE. Pass TRUE from all places where the crop outline
actually changed.
(gimp_crop_tool_control): added back the call to crop_recalc() for
the RESUME case so the outline gets updated on zoom/scroll, but pass
recalc_highlight = FALSE because it has not changed.
Fixes bug #157001.
2004-11-02 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/drawable_transform.pdb (flip): renamed
parameter "center" to "auto_center" and removed
"transform_direction". Renamed rotate() to rotate_free() and
added a "gboolean auto_center" parameter. Added new function
rotate() which takes enum GimpRotationType instead of an
arbiatrary angle so the flip and rotate APIs are symmetric.
* libgimp/gimp.def: added the gimp_drawable_transform_* stuff.
* app/pdb/drawable_transform_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
2004-11-02 Sven Neumann <sven@gimp.org>
* app/dialogs/image-scale-dialog.c (image_scale_callback): actually
use the choosen interpolation type. Fixes bug #157102.
2004-11-02 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig-dobject.h
* plug-ins/gfig/gfig-preview.c
* plug-ins/gfig/gfig-style.h
* plug-ins/gfig/gfig-types.h
* plug-ins/gfig/gfig.h: some more cleanups. The current_style bug is
still there :(
2004-11-01 Øyvind Kolås <pippin@gimp.org>
* app/xcf/xcf-load.c: applied patch from David Gowers, extra sanity
checking for the xcf loader, colormaps read from non indexed images
are discarded. Does not fix bug #134097, but prevents gimp from
reloading an impossible state.
2004-11-01 Michael Natterer <mitch@gimp.org>
* app/core/gimpdrawable-transform.[ch]
(gimp_drawable_transform_flip): renamed "center" to "auto_center".
(gimp_drawable_transform_rotate): added missing parameters so it
can be used for a to-be-added PDB wrapper offering a
GimpRotationType based rotate API.
Both functions: always clip when transforming a whole channel,
since they must keep their size.
(gimp_drawable_transform_affine): actually forward the passed
"clip_result" to transform_tiles_affine() instead of always FALSE.
2004-11-01 Øyvind Kolås <pippin@gimp.org>
* app/pdb/color_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpcolor_pdb.c
* libgimp/gimpcolor_pdb.h: regenerated
* tools/pdbgen/pdb/color.pdb: added levels-stretch to @procs, removed
metainformation from deprecated levels-auto.
2004-11-01 Øyvind Kolås <pippin@gimp.org>
* app/actions/drawable-actions.c
* app/actions/drawable-commands.c
* app/actions/drawable-commands.h
* app/base/levels.c
* app/base/levels.h
* app/core/gimpdrawable-levels.c
* app/core/gimpdrawable-levels.h
* app/pdb/color_cmds.c
* app/tools/gimplevelstool.c
* libgimp/gimpcolor_pdb.c
* menus/image-menu.xml
* menus/image-menu.xml.in
* tools/pdbgen/pdb/color.pdb: renamed [drawable-]levels-auto
to [drawable-]levels-stretch, anticipating other ways to automatically
determine levels settings, old PDB command maintained, but marked
as deprecated.
2004-11-01 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
don't check for file_proc->menu_paths. Our load and save procedure
don't necessarily register a menu path any longer.
* app/plug-in/plug-ins.c: minor cleanup.
* app/xcf/xcf.c (xcf_init): no need for adding menu paths for the
XCF load and save procedures.
* tools/pdbgen/pdb/fileops.pdb: fixed outdated documentation.
* app/pdb/fileops_cmds.c
* libgimp/gimpfileops_pdb.c: regenerated.
2004-11-01 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/drawable_transform.pdb: added "clip_result" to
the transform_options_args() utility function and changed all
wrappers accordingly. Removed "interpolation", "supersample" and
"recursion_level" args from drawable_transform_flip().
* app/pdb/drawable_transform_cmds.c
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
2004-11-01 Sven Neumann <sven@gimp.org>
* plug-ins/common/tiff.c (query): fixed typo.
2004-11-01 Michael Natterer <mitch@gimp.org>
* app/actions/drawable-actions.c: trailing whitespace.
* app/actions/drawable-commands.[ch]: partly revert alphabetical
ordering. Instead, group them as in drawable-actions.c and order
by alphabet inside the groups (different ordering in *-actions.c
and *-commands.c is inconvenient for the usual workflow of editing
both files at the same time).
* app/core/gimpdrawable-levels.h: indentation.
2004-11-01 Michael Natterer <mitch@gimp.org>
* themes/Small/gtkrc: don't change GtkDialog::button_spacing and
::action_area_border because it breaks alignment with all other
dialog spacings or borders (which are hardcoded).
2004-11-01 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-types.h: new file to hold the types gfig uses.
This makes the sources easier to read.
* plug-ins/gfig/Makefile.am: added gfig-types.h
* plug-ins/gfig/gfig.h: removed some types definitions and put them
in gfig-types.h and ...
* plug-ins/gfig/gfig-dobject.h
* plug-ins/gfig/gfig-style.h: ...into these files.
2004-10-31 Sven Neumann <sven@gimp.org>
* Made 2.2-pre1 release.
2004-10-31 Simon Budig <simon@gimp.org>
* data/images/gimp-splash.png: new splash based on a great photo
(and pumpkin) by Seth Burgess <sjburges@gimp.org>.
2004-10-31 Simon Budig <simon@gimp.org>
* plug-ins/common/plasma.c: Fixed handling of 1x1 selection and
selection out of drawable.
2004-10-31 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/Makefile.am (EXTRA_DIST): removed pix-data.h.
2004-10-31 Sven Neumann <sven@gimp.org>
* configure.in: changed gimp_version to 2.2-pre1, to match the
naming scheme of the 2.0 pre-releases.
2004-10-31 Sven Neumann <sven@gimp.org>
* plug-ins/common/newsprint.c: removed an unused variable.
2004-10-31 Sven Neumann <sven@gimp.org>
* app/dialogs/user-install-dialog.c: when migrating the user
settings, tolerate errors and create the tmp directory that was
explicitely not copied.
2004-10-31 Sven Neumann <sven@gimp.org>
* app/config/gimpconfig-utils.c (gimp_config_file_copy): copy the
file permissions also.
* app/dialogs/user-install-dialog.c: added code to migrate user
settings from ~/.gimp-2.0. It copies all files (except GIMP swap
files) and all subdirectories (except tmp) with all files. It
doesn't recurse into subdirectories.
2004-10-31 Sven Neumann <sven@gimp.org>
* app/config/gimpguiconfig.c: disabled the image area by default
to reduce some clutter.
2004-10-31 Sven Neumann <sven@gimp.org>
* app/dialogs/user-install-dialog.c: fixed page logic for migration
of user settings. Still missing code to actually copy the files.
2004-10-31 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpmemsizeentry.c: don't use camel case in memory
size identifiers.
2004-10-31 Sven Neumann <sven@gimp.org>
* app/widgets/gimpimageeditor.c (gimp_image_editor_set_context):
set the active image. Fixes bug #156942.
2004-10-31 Sven Neumann <sven@gimp.org>
* app/dialogs/user-install-dialog.c: started to work on migration of
user settings (bug #156636). Not at all functional yet.
2004-10-31 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpwidgets.c: allow for mnemonics in radio
groups created with gimp_radio_group_new().
2004-10-31 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-dobject.c: some more UI improvements.
2004-10-31 Sven Neumann <sven@gimp.org>
* app/widgets/gimpsizebox.c: added a size entry to edit the
resolution. This should close bug #151022.
2004-10-31 Sven Neumann <sven@gimp.org>
* app/dialogs/resize-dialog.c: connect the offset controls.
2004-10-30 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig-style.c: fixed some annoying popup messages at
the price of a smallish mem-leak that I will fix later.
2004-10-30 Sven Neumann <sven@gimp.org>
* app/composite/gimp-composite-generic.c
(gimp_composite_hue_any_any_any_generic): do nothing if the color
has no saturation. Patch by Joao S. Bueno. Fixes bug #123296.
2004-10-30 Sven Neumann <sven@gimp.org>
* app/actions/image-commands.c (image_scale_cmd_callback): destroy
the scale dialog when the display is disconnected.
* app/dialogs/resize-dialog.c: fixed a couple of bugs related to
the offset area. Still work in progress.
2004-10-30 DindinX <dindinx@gimp.org>
* plug-ins/common/newsprint.c: Moved the preview to the left, as
suggested by Joao S. O. Bueno.
2004-10-30 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-line.c
* plug-ins/gfig/gfig-line.h
* plug-ins/gfig/gfig-poly.c
* plug-ins/gfig/gfig-preview.c
* plug-ins/gfig/gfig-star.c
* plug-ins/gfig/gfig-style.c
* plug-ins/gfig/gfig-style.h: some more cleanups and UI tweaks. Still
work in progress.
* plug-ins/gfig/pix-data.h: removed this empty, unused file.
2004-10-30 Sven Neumann <sven@gimp.org>
* app/config/gimpguiconfig.[ch]
* app/config/gimprc-blurbs.h
* app/dialogs/preferences-dialog.c
* app/tools/gimpmoveoptions.[ch]
* app/tools/gimpmovetool.[ch]: reverted changes for bug #156801.
Instead added a gimprc option that allows to get the old behaviour
back.
2004-10-30 Sven Neumann <sven@gimp.org>
* app/tools/gimpmoveoptions.[ch]
* app/tools/gimpmovetool.[ch]: applied (cleaned up version of) a
patch from Joao S. O. Bueno that adds a tool-option to restore the
old Move tool behaviour. Fixes bug #156801.
2004-10-30 Sven Neumann <sven@gimp.org>
* plug-ins/common/despeckle.c: applied a patch from Geert Jordaens
that improves the Despeckle algorithm. See bug #72862.
2004-10-29 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/siod-wrapper.c (init_constants): Updated to
use convert_string() to change name of constant to Scheme format.
2004-10-30 Sven Neumann <sven@gimp.org>
* INSTALL
* NEWS
* README: updated for 2.2 pre-releases.
2004-10-30 Sven Neumann <sven@gimp.org>
* plug-ins/common/grid.c (run): applied patch by Joao S. O. Bueno
that implements the opacity parameters the way it is documented.
Fixes bug #156750.
2004-10-30 Sven Neumann <sven@gimp.org>
* plug-ins/common/glasstile.c: applied patch from Yeti, updated by
Kevin Cozens and modified by me. Fixes bug #85261.
2004-10-29 Øyvind Kolås <pippin@gimp.org>
* tools/pdbgen/pdb/color.pdb: moved body of code from here.
* app/core/gimpdrawable-levels.[ch]: to here.
* app/core/Makefile.am: added gimpdrawable-levels.[ch].
* app/pdb/color_cmds.c: regenerated.
* app/actions/drawable-actions.c
* app/actions/drawable-commands.[ch]: added drawable-layers-auto
action.
* app/widgets/gimphelp-ids.h: added GIMP_HELP_LAYER_WHITE_BALANCE.
* app/menus/image-menu.xml.in: added new auto/White Balance action.
* app/menus/image-menu.xml: regenerated.
2004-10-29 Sven Neumann <sven@gimp.org>
* app/widgets/gimpuimanager.c (gimp_ui_manager_entry_load)
* app/widgets/gimpclipboard.c (gimp_clipboard_init): only be
verbose on request.
* app/plug-in/plug-in.c (plug_in_close): turned warnings into
messages and respect gimp->be_verbose.
2004-10-29 Øyvind Kolås <pippin@gimp.org>
* app/actions/drawable-commands.[ch]
* app/actions/drawable-actions.[ch]: alphabetized file pending
addition.
2004-10-29 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/test-sphere.scm: Added notes about
use of SF-PALETTE.
2004-10-29 Sven Neumann <sven@gimp.org>
* plug-ins/common/jpeg.c: pass the name in filesystem encoding to
gimp_image_set_filename(). Fixes bug #153751 for the JPEG plug-in.
2004-10-29 Sven Neumann <sven@gimp.org>
* app/file/file-utils.c (file_utils_uri_to_utf8_filename): when
the filename cannot be converted to UTF-8, warn and return the URI
instead. This is a workaround for the crash described in bug #153751.
2004-10-29 Michael Natterer <mitch@gimp.org>
* app/dialogs/dialogs.c (toplevel_entries): added foreign entries
for the keyboard shortcut and the controller action dialogs.
* app/dialogs/preferences-dialog.c
* app/widgets/gimpcontrollereditor.c: register the dialogs with
the "toplevel" dialog factory so they remember their size and
position.
2004-10-29 Michael Natterer <mitch@gimp.org>
* plug-ins/dbbrowser/gimpprocbrowser.c
* plug-ins/dbbrowser/plugin-browser.c: don't say "1 Procedures" or
"1 Plug-In Interfaces" but use the singular form instead.
2004-10-29 Michael Natterer <mitch@gimp.org>
* plug-ins/common/flarefx.c
* plug-ins/common/nova.c: changed preview cursors to GDK_CROSSHAIR.
* plug-ins/common/iwarp.c
* plug-ins/gflare/gflare.c
* plug-ins/ifscompose/ifscompose.c: added GDK_CROSSHAIR preview
cursors. Not quite perfect for IfsCompose (actually needs tool-
and constext-sensitive cursors) but definitely better than
before. Fixes bug #90519.
2004-10-29 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/edit.pdb: mention gimp_drawable_fill() in the
docs for gimp_edit_fill().
* app/pdb/edit_cmds.c
* libgimp/gimpedit_pdb.c: regenerated.
2004-10-28 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-arc.c
* plug-ins/gfig/gfig-bezier.c
* plug-ins/gfig/gfig-bezier.h
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-dialog.h
* plug-ins/gfig/gfig-dobject.c
* plug-ins/gfig/gfig-dobject.h
* plug-ins/gfig/gfig-ellipse.c
* plug-ins/gfig/gfig-grid.c
* plug-ins/gfig/gfig-grid.h
* plug-ins/gfig/gfig.c: small cleanups
2004-10-28 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablecombobox.c
* libgimp/gimpimagecombobox.c: changed the API docs to suggest to
use gimp_int_combo_box_connect() with these widgets. We don't want
more people to be caught by bug #156659.
2004-10-28 Sven Neumann <sven@gimp.org>
* plug-ins/common/grid.c: fixed a long-standing cut'n'paste bug
which caused the intersection color to be drawn with the wrong
shade of gray when drawing on a grayscale drawable.
2004-10-28 Sven Neumann <sven@gimp.org>
* app/dialogs/resize-dialog.c: added the offset area back. Still
work in progress.
2004-10-28 Sven Neumann <sven@gimp.org>
* plug-ins/helpbrowser/dialog.c: only create a "Document not
found" error page if the requested URL was a page to load, not a
supplementary URL like an image. Fixes bug #138275.
2004-10-28 Sven Neumann <sven@gimp.org>
* plug-ins/bmp/bmp.c
* plug-ins/common/CEL.c
* plug-ins/common/aa.c
* plug-ins/common/compressor.c
* plug-ins/common/csource.c
* plug-ins/common/dicom.c
* plug-ins/common/gbr.c
* plug-ins/common/gif.c
* plug-ins/common/gifload.c
* plug-ins/common/gih.c
* plug-ins/common/gtm.c
* plug-ins/common/header.c
* plug-ins/common/jpeg.c
* plug-ins/common/mng.c
* plug-ins/common/pat.c
* plug-ins/common/pcx.c
* plug-ins/common/pix.c
* plug-ins/common/png.c
* plug-ins/common/pnm.c
* plug-ins/common/postscript.c
* plug-ins/common/psd.c
* plug-ins/common/psd_save.c
* plug-ins/common/psp.c
* plug-ins/common/sunras.c
* plug-ins/common/svg.c
* plug-ins/common/tga.c
* plug-ins/common/tiff.c
* plug-ins/common/url.c
* plug-ins/common/wmf.c
* plug-ins/common/xbm.c
* plug-ins/common/xpm.c
* plug-ins/common/xwd.c
* plug-ins/faxg3/faxg3.c
* plug-ins/fits/fits.c
* plug-ins/gfli/gfli.c
* plug-ins/sgi/sgi.c
* plug-ins/winicon/main.c
* plug-ins/xjt/xjt.c: removed the calls to gimp_plugin_menu_register()
from all plug-ins. File plug-ins don't register into a menu any longer.
2004-10-28 Sven Neumann <sven@gimp.org>
* plug-ins/common/raw.c (query): do not install an extension for
the raw plug-in to avoid confusion with the dcraw format.
2004-10-28 Sven Neumann <sven@gimp.org>
* app/actions/layers-actions.c (layers_actions_update): do not set
the "layers-mask-add" action insensitive if there's no alpha channel.
* app/actions/layers-commands.c (layers_add_mask_response): add an
alpha channel if there isn't one already. Fixes bug #156676.
2004-10-28 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
use gimp_int_combo_box_connect() so that the initial selection
causes the "changed" callback to be run. Should fix bug #156659.
2004-10-28 Øyvind Kolås <pippin@gimp.org>
* app/display/gimpdisplayshell-preview.c: Improve preview accuracy of
perspective transform, by subdiving into a 5x5 grid.
Fixes bug #152222.
2004-10-27 Philip Lafleur <plafleur@cvs.gnome.org>
* app/display/gimpdisplayshell-preview.c: Really fixed all cases
of the perspective tool preview breaking with certain orientations by
using triangles instead of quads.
2004-10-27 Philip Lafleur <plafleur@cvs.gnome.org>
* app/display/gimpdisplayshell-preview.c: Hopefully fixed all cases
of the perspective tool preview breaking with certain orientations.
2004-10-27 Manish Singh <yosh@gimp.org>
* tools/pdbgen/enumcode.pl: Don't declare $first twice.
* libgimp/Makefile.am: Be sure to distribute gimpenums.c.tail.
* libgimp/gimpenums.c.tail: Added into CVS.
2004-10-27 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-bezier.[ch]: added a notebook page for the
bezier tool options instead of yet another popup window.
* plug-ins/gfig/gfig-dialog.c: modified accordingly and HIGed a bit.
2004-10-27 Øyvind Kolås <pippin@gimp.org>
* app/core/gimpdrawable-transform.c: made the fixed point used in
supersampling configurable (in source) and changed from 15.16 to
21.10 fixed point.
Fixes bug #128594 for drawables less than 2G wide.
2004-10-27 Michael Schumacher <schumaml@gmx.de>
* app/widgets/gimpwidgets-utils.c: fixed a typo in
#include "libgimpbase/gimpwin32-io.h"
2004-10-27 DindinX <dindinx@gimp.org>
* plug-ins/gfig/gfig-dialog.[ch]
* plug-ins/gfig/gfig-poly.[ch]
* plug-ins/gfig/gfig-spiral.[ch]
* plug-ins/gfig/gfig-star.[ch]
* plug-ins/gfig/gfig.h: first step of moving all the hidden popup
dialogs for the tool options in a GtkNotebook showing the options
within one page for each tool.
2004-10-27 Sven Neumann <sven@gimp.org>
* tools/pdbgen/enumcode.pl: removed trailing commmas from output.
2004-10-27 Sven Neumann <sven@gimp.org>
* tools/pdbgen/enumcode.pl: fixed loop control in
_gimp_enums_init(). This caused all plug-ins to crash immidiately.
You will need to make sure that libgimp/gimpenums.c.tail is
recreated and appended to libgimp/gimpenums.c
2004-10-27 Michael Natterer <mitch@gimp.org>
* app/core/gimp-transform-utils.[ch]. switch from x1,y1,x2,y2
bounding boxes to x,y,width,height ones. Added
gimp_transform_matrix_flip_free(). Renamed some parameters to be
consistent with others. Some internal cleanup.
* app/tools/gimpperspectivetool.c
* app/tools/gimpscaletool.c
* app/tools/gimpsheartool.c
* tools/pdbgen/pdb/drawable_transform.pdb
* tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.
* tools/pdbgen/pdb/drawable_transform.pdb
* tools/pdbgen/pdb/transform_tools.pdb: guard all transform
wrappers with if(gimp_drawable_mask_intersect(...)), also the
ones which don't need the returned bounding box.
* tools/pdbgen/pdb/drawable_transform.pdb: renamed some parameters
and added gimp_drawable_transform_matrix() which takes the 9
coefficients of a 3x3 matrix for ultimate flexibility ;)
* app/pdb/drawable_transform_cmds.c
* app/pdb/internal_procs.c
* app/pdb/transform_tools_cmds.c
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
2004-10-27 Sven Neumann <sven@gimp.org>
* app/actions/dockable-actions.c (dockable_toggle_actions): changed
menu label from "Show Image Menu" to "Show Image Selection".
* app/widgets/gimpsizebox.c: unmarked a string for translation.
* app/dialogs/scale-dialog.c: added back the message when scaling
an indexed image.
2004-10-27 DindinX <dindinx@gimp.org>
* libgimp/gimpaspectpreview.c: really use the second parameter of
gimp_aspect_preview_new (), so plug-ins can now really remember the
state of the preview between invocations.
* libgimpwidgets/gimpscrolledpreview.c: fix a little typo
* plug-ins/common/channel_mixer.c: fix a warning by using TRUE for a
boolean value (initial state of the preview) instead of a weird NULL.
2004-10-27 Michael Natterer <mitch@gimp.org>
* modules/controller_linux_input.c
* modules/controller_midi.c: don't g_free(error) but
g_clear_error(&error) the GError.
2004-10-27 Sven Neumann <sven@gimp.org>
* app/dialogs/resize-dialog.[ch]: started to redo the Resize
dialog in the style of the new Scale dialog. Only halfway done but
at least the new API is there.
* app/actions/image-commands.c
* app/actions/layers-commands.c: changed accordingly.
* app/dialogs/image-scale-dialog.c: cosmetics.
2004-10-27 DindinX <dindinx@gimp.org>
* plug-ins/gfig/*[ch]: preliminary cleanups: removed all trailing
spaces.
2004-10-26 Manish Singh <yosh@gimp.org>
* tools/pdbgen/pdb/drawable_transform.pdb: removed abuse of init,
called pdb_misc in all procedures.
* app/pdb/drawable_transform_cmds.c
* libgimp/gimpdrawabletransform_pdb.c: regenerated.
2004-10-27 Sven Neumann <sven@gimp.org>
* libgimp/Makefile.am (PDB_WRAPPERS_H, PDB_WRAPPERS_C): added new
files gimpdrawabletranform_pdb.[ch].
2004-10-27 Sven Neumann <sven@gimp.org>
* app/dialogs/Makefile.am
* app/dialogs/image-scale-dialog.[ch]: a wrapper around the scale
dialog that takes care of verifying the user input and optionally
asking for confirmation. Most of this moved out of image-commands.c.
* app/actions/image-commands.c: use the new image scale dialog
even though it doesn't allow to edit the resolution yet. That's a
temporary regression that will get fixed soon.
* app/actions/layers-commands.c: cosmetics.
* app/dialogs/scale-dialog.c (scale_dialog_reset): also reset the
resolution.
* app/widgets/gimpsizebox.c: fixed cut'n'paste error.
2004-10-27 Sven Neumann <sven@gimp.org>
* app/widgets/gimpsizebox.[ch]: added a resolution label similar
to one in the template editor. Prepared for editable resolution,
work in progress...
* app/dialogs/scale-dialog.[ch]: added resolution and resolution
unit parameters to ScaleDialogCallback.
* app/actions/layers-commands.c: changed accordingly.
2004-10-26 Sven Neumann <sven@gimp.org>
* app/widgets/gimptemplateeditor.c: commented out the memory size
label. The visual clutter of it's bold appearance was IMO not
appropriate. I think the dialog is better without it.
* app/widgets/gimpsizebox.c: added a pixel size label as in the
Image New dialog.
2004-10-26 Sven Neumann <sven@gimp.org>
* tools/pdbgen/enumcode.pl: added gtk-doc comment for
gimp_enums_get_type_names().
2004-10-26 Sven Neumann <sven@gimp.org>
* plug-ins/common/retinex.c: applied patch by Geert Jordaens that
lets Retinex deal with RGBA drawables. Closes bug #135594 again.
2004-10-26 Sven Neumann <sven@gimp.org>
Added new drawable transform API to the PDB. Largely based on
patches from Joao S. O. Bueno. Fixes bug #137053.
* app/core/gimpdrawable-transform.[ch]: added missing parameters
to gimp_drawable_transform_flip().
* tools/pdbgen/pdb/transform_tools.pdb: changed accordinly.
* app/base/base-enums.h
* app/core/core-enums.h: removed pdp-skip for GimpInterpolationType
and GimpTransformDirection enums.
* libgimp/gimpenums.h
* plug-ins/pygimp/gimpenums.py
* tools/pdbgen/enums.pl
* tools/pdbgen/groups.pl: regenerated.
* tools/pdbgen/Makefile.am
* tools/pdbgen/pdb/drawable_transform.pdb: added new file defining
the new PDB calls.
* app/pdb/Makefile.am
* app/pdb/drawable_transform_cmds.c
* app/pdb/internal_procs.c
* app/pdb/transform_tools_cmds.c
* libgimp/gimp_pdb.h
* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
2004-10-26 Michael Natterer <mitch@gimp.org>
* modules/controller_linux_input.c
* modules/controller_midi.c: don't enter an infinite blocking loop
when the user selects an input file that can be opened, but not
read (like a directory).
2004-10-26 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpactionview.[ch] (gimp_action_view_new): added
parameter "const gchar *select_action" and preselect the passed
action if non-NULL. Made the column enum public to users of this
widget can get data from its tree store.
* app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog):
pass NULL because we don't want a preselected action here.
* app/widgets/gimpcontrollereditor.[ch]: added "Edit" and "Delete"
buttons to change the event -> action mapping. Implement a action
chooser dialog using GimpActionView. Fixes bug #106920.
2004-10-26 Sven Neumann <sven@gimp.org>
* app/actions/channels-commands.c
* app/core/gimpchannel-select.c
* app/core/gimpimagefile.c
* app/core/gimpundo.c
* app/widgets/gimpcomponenteditor.c: use the new enum utility
functions from libgimpbase instead of accessing enum_value->value_name.
2004-10-26 Michael Natterer <mitch@gimp.org>
* app/dialogs/quit-dialog.c (quit_dialog_container_changed): when
changing the button's label to "Quit", also make it the default
action.
2004-10-26 Michael Natterer <mitch@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpcontrollereditor.[ch]: new widget built from
preliminary code from the prefs dialog. Prerequisite for finally
fixing bug #106920.
* app/dialogs/preferences-dialog.c: use the new widget.
2004-10-26 Michael Natterer <mitch@gimp.org>
* plug-ins/common/retinex.c: cleaned up the GUI and GIMP-specific
code a bit. Use gimp_drawable_mask_intersect().
2004-10-25 Manish Singh <yosh@gimp.org>
* tools/pdbgen/enumcode.pl: Use $1 instead of deprecated \1 for
regexp group.
2004-10-26 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
my last change removed the sanity check for array_length >= 0.
Put it back.
2004-10-26 Michael Natterer <mitch@gimp.org>
* libgimpbase/gimpbase.def: updated.
2004-10-25 DindinX <dindinx@gimp.org>
* plug-ins/common/retinex.c: added this new plug-in.
Addresses bug #135594
* plug-ins/common/plugin-defs.pl: modified accordingly.
* plug-ins/common/.cvsignore
* plug-ins/common/Makefile.am: regenerated.
* plug-ins/gfig/gfig-arc.c
* plug-ins/gfig/gfig-arc.h
* plug-ins/gfig/gfig-circle.c
* plug-ins/gfig/gfig-circle.h
* plug-ins/gfig/gfig-dialog.c: smallish style cleanups
2004-10-25 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
silently accept arrays which are longer than specified. Nothing
bad can happen and it's common practice to resize arrays in fixed
size chunks so avoid frequent resizing. Fixes bug #155359.
2004-10-25 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/siod-wrapper.c (init_constants): removed
debugging output i forgot.
2004-10-25 Sven Neumann <sven@gimp.org>
* app/dialogs/quit-dialog.c: change the action button's label to
"Quit" if there are no images with unsaved changes.
2004-10-25 Michael Natterer <mitch@gimp.org>
* libgimpbase/gimpbaseenums.[ch]: register some missing enums.
* tools/pdbgen/enumcode.pl: removed code to generate
plug-ins/script-fu/script-fu-constants.c, generate code to
explicitely initialize and query all of libgimp*'s enums
and write it to libgimp/gimpenums.c.tail
* libgimp/gimpenums.h: regenerated.
* libgimp/Makefile.am: append gimpenums.c.tail to gimpenums.c
* libgimp/gimp.c (gimp_main): call g_type_init() and
_gimp_enums_init().
* libgimp/gimp.def: added gimp_enums_get_type_names().
* plug-ins/script-fu/Makefile.am
* plug-ins/script-fu/script-fu-constants.[ch]: removed these files.
* plug-ins/script-fu/siod-wrapper.c: dynamically register all
constants using gimp_enums_get_type_names() and introspection.
Also register the built-in unit types.
* plug-ins/script-fu/script-fu.c: changed accordingly.
2004-10-25 Michael Natterer <mitch@gimp.org>
Don't store human readable and translatable enum/flag strings in
GEnumValue's and GTypeValue's fields but attach them to their
GType using separate structs and utility functions:
* tools/gimp-mkenums: added params and perl voodoo to support
generating a second array of values, which is used by the
Makefiles below to create and register arrays of value
descriptions.
* libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
arrays of translatable strings to/from enum and flags types. Added
structs GimpEnumDesc and GimpFlagsDesc for that purpose.
* libgimpbase/gimputils.[ch]: changed existing enum utility
functions, added new ones and added a symmetric API for flags.
* app/base/Makefile.am
* app/core/Makefile.am
* app/display/Makefile.am
* app/paint/Makefile.am
* app/text/Makefile.am
* app/tools/Makefile.am
* app/widgets/Makefile.am
* libgimp/Makefile.am
* libgimpbase/Makefile.am: changed *-enums.c generation rules
accordingly.
* app/base/base-enums.c
* app/core/core-enums.c
* app/display/display-enums.c
* app/paint/paint-enums.c
* app/text/text-enums.c
* app/tools/tools-enums.c
* app/widgets/widgets-enums.c
* libgimpbase/gimpbaseenums.c: regenerated.
* app/widgets/gimpenumstore.c
* app/widgets/gimpenumwidgets.c
* app/widgets/gimptemplateeditor.c
* libgimpwidgets/gimppreviewarea.c: follow the enum utility
function API changes.
2004-10-25 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_cmd_gimp_guides.c
* plug-ins/imagemap/imap_edit_area_info.c
* plug-ins/imagemap/imap_main.c
* plug-ins/imagemap/imap_menu.[ch]
* plug-ins/imagemap/imap_menu_funcs.[ch]
* plug-ins/imagemap/imap_misc.c
* plug-ins/imagemap/imap_settings.c
* plug-ins/imagemap/imap_source.c: added a menu entry for Help.
Did more minor layout adjustments for HIG compliance.
2004-10-25 Michael Natterer <mitch@gimp.org>
* app/core/gimpobject.c: #include "libgimpbase/gimpbase.h", not
just gimputils.h
2004-10-25 Michael Natterer <mitch@gimp.org>
* menus/toolbox-menu.xml.in: commented out the "Debug" submenu.
Should do this via an xsltproc --param actually...
2004-10-25 DindinX <dindinx@gimp.org>
* plug-ins/common/newsprint.c: removed debugging g_print and
remove my memory fix, since it was buggy and shouldn't be done.
My fix just broke this plug-in (reported by Joao S. O. Bueno
Calligaris)
2004-10-25 Simon Budig <simon@gimp.org>
* app/tools/gimpvectortool.c: Switch to design mode when
Escape gets pressed. Untabbified.
2004-10-25 Michael Natterer <mitch@gimp.org>
* app/actions/gradient-editor-commands.c
* app/display/gimpdisplayshell-preview.c: irrelevant coding style
and spacing cleanups.
* app/widgets/gimpimageeditor.c: removed utility function
gimp_image_editor_context_changed() and connect
gimp_image_editor_set_image() directly using
g_signal_connect_swapped().
2004-10-25 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_circle.c
* plug-ins/imagemap/imap_cmd_gimp_guides.c
* plug-ins/imagemap/imap_cmd_guides.c
* plug-ins/imagemap/imap_default_dialog.[ch]
* plug-ins/imagemap/imap_edit_area_info.c
* plug-ins/imagemap/imap_grid.c
* plug-ins/imagemap/imap_main.c
* plug-ins/imagemap/imap_misc.c
* plug-ins/imagemap/imap_polygon.c
* plug-ins/imagemap/imap_preferences.c
* plug-ins/imagemap/imap_rectangle.c
* plug-ins/imagemap/imap_selection.c
* plug-ins/imagemap/imap_source.c
* plug-ins/imagemap/imap_toolbar.c
* plug-ins/imagemap/imap_tools.c: reviewed for HIG
compliance. Various other minor fixes. Closes bug #150004.
2004-10-25 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/test-sphere.scm: Added parameter
missing from argument list.
2004-10-25 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/enumcode.pl
* libgimp/Makefile.am: register all enums in libgimp/gimpenums.h
with the type system.
* libgimp/gimpenums.h: regenerated.
* libgimp/gimp.def: updated.
2004-10-25 Sven Neumann <sven@gimp.org>
* configure.in: gimp_user_version should be 2.2.
* libgimpmodule/Makefile.am (AM_CPPFLAGS): cleanup.
2004-10-25 Sven Neumann <sven@gimp.org>
* configure.in:
* app/Makefile.am
* tools/Makefile.am: bumped version to 2.2.0-pre1, set app version
to 2.2, reset other versions to 2.0. Changed library versioning so
we install with the same soname as gimp-2.0 again.
2004-10-25 Sven Neumann <sven@gimp.org>
* app/core/gimpimagefile.c (gimp_imagefile_get_desc_string): say
"Click to create preview" if no preview is available.
2004-10-25 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_save()
which saves a GtkTextBuffer's contents to a file.
* app/widgets/gimperrorconsole.c: use
gimp_editor_add_action_button() and removed all "clicked"
callbacks, including all file saving code.
* app/actions/error-console-actions.c
* app/actions/error-console-commands.[ch]: added the code removed
above to the action callbacks. Use gimp_text_buffer_save().
2004-10-24 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpgradienteditor.[ch]
* app/widgets/gimppaletteeditor.[ch]: added public APIs for
zooming the editors. Use gimp_editor_add_action_button() to create
all buttons. Removed all button callbacks and all duplicated
button sensitivity logic.
* app/widgets/gimpdataeditor.c (gimp_data_editor_set_data): update
the editor's UI manager if it exists.
* app/actions/gradient-editor-actions.c
* app/actions/gradient-editor-commands.[ch]: added zoom actions
and callback and call gimp_gradient_editor_zoom(). Fixed
gradient_editor_actions_update() to actually set all items'
sensitivity (it was possible to modify read-only gradients and
even to crash GIMP).
* app/actions/palette-editor-actions.c
* app/actions/palette-editor-commands.[ch]: changed "new" and
"zoom" actions to actually do their job instead of calling
gtk_button_clicked(editor->foo_button).
2004-10-24 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcolormapeditor.c: removed the "Edit Color"
dialog callbacks and use gimp_editor_add_action_button() for
the edit button. Removed button sensitivity logic. Hide the
color dialog when the image's mode changes.
* app/actions/colormap-editor-actions.c: added missing tooltip
for the edit action.
* app/actions/colormap-editor-commands.c: implement the dialog
here.
2004-10-24 DindinX <dindinx@gimp.org>
* app/core/gimpdrawable-desaturate.c: only return early if there's
nothing to desaturate.
2004-10-24 Michael Natterer <mitch@gimp.org>
* app/actions/vectors-commands.c: don't leak the filenames of the
import and export dialogs.
2004-10-24 Michael Natterer <mitch@gimp.org>
* app/dialogs/Makefile.am
* app/dialogs/vectors-export-dialog.[ch]
* app/dialogs/vectors-import-dialog.[ch]: new files.
* app/actions/vectors-commands.c: use the new dialogs and remember
their last values.
2004-10-23 Sven Neumann <sven@gimp.org>
* app/actions/vectors-commands.c: added missing controls to the
path import and export dialogs.
2004-10-23 DindinX <dindinx@gimp.org>
* plug-ins/common/newsprint.c: cleaned it up, fixed a (documented)
memory leak and the weird behaviour of the resolution scales.
2004-10-23 DindinX <dindinx@gimp.org>
* plug-ins/common/newsprint.c: added a preview.
2004-10-23 Michael Natterer <mitch@gimp.org>
* libgimp/gimpaspectpreview.h
* libgimp/gimpdrawablepreview.h
* libgimp/gimpprogressbar.h
* libgimpwidgets/gimpcellrenderercolor.h
* libgimpwidgets/gimpcellrenderertoggle.h
* libgimpwidgets/gimpframe.h
* libgimpwidgets/gimpintcombobox.h
* libgimpwidgets/gimpintstore.h
* libgimpwidgets/gimppreview.h
* libgimpwidgets/gimppreviewarea.h
* libgimpwidgets/gimpscrolledpreview.h: added padding to all class
structs which have been added since 2.0.
2004-10-23 Michael Natterer <mitch@gimp.org>
* app/actions/file-commands.c (file_save_cmd_callback): don't
g_return_if_fail() if there is no active drawable, just silently
return.
* app/actions/image-commands.c: remember the last merge_type of
the "Merge Visible Layers" dialog.
* app/actions/layers-commands.c: remeber the last values of the
"Add Layer Mask" dialog.
* app/actions/select-commands.c: renamed a bunch of static
variables to be consistent with other variables used to remember
dialog values.
* app/actions/view-commands.c (view_fullscreen_cmd_callback): it's
useless to update the "view-fullscreen" actions here because the
"fullscreen" state of the shell changes asynchronously
2004-10-23 Michael Natterer <mitch@gimp.org>
* app/dialogs/image-merge-layers-dialog.c
* app/dialogs/layer-add-mask-dialog.c: made them not resizable.
* app/dialogs/convert-dialog.c
* app/dialogs/offset-dialog.c: renamed ugly variables.
* app/dialogs/image-new-dialog.c
* app/dialogs/stroke-dialog.c: irrelevant pedantic code reordering.
2004-10-23 Michael Natterer <mitch@gimp.org>
* app/dialogs/Makefile.am
* app/dialogs/image-merge-layers-dialog.[ch]: one more dialog split
out of actions/.
* app/actions/image-commands.c: removed it here. Some cleanup.
2004-10-23 Sven Neumann <sven@gimp.org>
* libgimpthumb/gimpthumb-utils.[ch]
* libgimpthumb/gimpthumbnail.[ch]
* libgimpthumb/gimpthumb.def: added missing API, mainly for deleting
thumbnails.
* app/core/gimpimagefile.[ch]: when saving a thumbnail, delete a
failure thumbnail if one exists. Unless the thumbnail was created
explicitely, remove all other thumbnails for this image.
* app/actions/documents-commands.c: changed accordingly.
* app/file/file-open.c: only save a thumbnail if there isn't a
valid thumbnail already.
* app/widgets/gimpthumbbox.c: before attempting to create a new
thumbnail, check if there's an uptodate failure thumbnail.
2004-10-23 Michael Natterer <mitch@gimp.org>
* app/dialogs/Makefile.am
* app/dialogs/layer-add-mask-dialog.[ch]: one more dialog split
out of actions/.
* app/actions/layers-commands.c: removed it here. Some cleanup.
2004-10-23 Michael Natterer <mitch@gimp.org>
* autogen.sh: don't tell nonsense by printing "I am going to run
./configure with no arguments", because we always pass at least
--enable-maintainer-mode. Instead, simply always print all
arguments. Also removed --copy from the calls to glib-gettextize
and intltoolize.
2004-10-23 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpstock.c: added labels ("_Stroke") to the
SLEECTION_STROKE and PATH_STROKE stock items so they can be used
in action areas.
* app/widgets/gimpstrokeeditor.c: changed mnemonic to no clash
with "_Stroke" and reordered some code.
* app/dialogs/stroke-dialog.[ch]: use the passed stock_id instead
of GTK_STOCK_OK. Added parameters to specify the dialog's title
so it doesn't say "Stroke Options".
* app/actions/select-commands.c
* app/actions/vectors-commands.c
* app/tools/gimpvectortool.c: pass "Stroke Selection" and "Stroke
Path" as dialog titles.
2004-10-23 Michael Natterer <mitch@gimp.org>
When there are variants of actions with and without dialog, let
the dialog-less actions try to use the values from the last dialog
invocation:
* app/actions/channels-actions.c
* app/actions/channels-commands.[ch]
* app/actions/layers-actions.c
* app/actions/layers-commands.[ch]
* app/actions/vectors-actions.c
* app/actions/vectors-commands.[ch]: renamed the foo-new-defaults
actions to foo-new-last-values and use the last values entered in
the dialogs.
* app/widgets/gimpchanneltreeview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpvectorstreeview.c: changed accordingly. Show
the dialog on clicking "New" and call the last-values action on
<shift>+click.
* app/actions/select-actions.c
* app/actions/vectors-commands.c: renamed the foo-stroke-last-vals
to -last-values.
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpvectorstreeview.c: stroke with last values on
<shift> clicking the stroke buttons.
2004-10-23 Sven Neumann <sven@gimp.org>
* libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save): save to a
temporary file to avoid problems with concurrent thumbnail
creation.
2004-10-23 Michael Natterer <mitch@gimp.org>
* app/dialogs/Makefile.am
* app/dialogs/layer-options-dialog.[ch]: the new/edit layer dialog.
* app/actions/layers-commands.c: use it here.
2004-10-22 Sven Neumann <sven@gimp.org>
* app/tools/gimpimagemaptool.[ch]
* app/tools/gimpcurvestool.c
* app/tools/gimplevelstool.c: allow to Shift-click the Load and
Save buttons to skip the file chooser dialog and reuse the last
used filename. Fixes bug #75558.
2004-10-22 Michael Natterer <mitch@gimp.org>
* app/dialogs/Makefile.am
* app/dialogs/template-options-dialog.[ch]: the new/edit template
dialog.
* app/actions/templates-commands.c: removed the code here and use
template_options_dialog_new(). Removed utility functions. Some
cleanup.
2004-10-22 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpeditor.c (gimp_editor_ensure_button_box): make
sure the button_box is always interted at the very bottom of the
editor.
* app/widgets/gimpviewabledialog.c: changed the "description"
property from CONSTRUCT_ONLY to CONSTRUCT.
* app/widgets/gimpcolormapeditor.c: show the index of the edited
color in the color dialog and use the correct icon. Replaced label
"Hex triplet" by "HTML notation" to be consistent with the color
dialog. Removed wrong 2 pixel border around the table below the
preview.
2004-10-22 Sven Neumann <sven@gimp.org>
* plug-ins/common/wmf.c: fixed non-interactive call with default
values.
2004-10-22 Sven Neumann <sven@gimp.org>
* app/actions/colormap-editor-actions.c
* app/actions/dialogs-actions.c
* app/core/gimpimage-colormap.c
* app/dialogs/convert-dialog.c
* app/dialogs/dialogs.c
* app/widgets/gimpcolormapeditor.c: use the term "Colormap"
instead of "Indexed Palette". Fixes bug #155829.
2004-10-22 Sven Neumann <sven@gimp.org>
* plug-ins/common/wmf.c: applied a patch by Karine Proot that adds
a preview to the load dialog and a similar UI as the SVG loader.
Fixes bug #133519 and bug #133521.
2004-10-22 Michael Natterer <mitch@gimp.org>
* app/core/core-enums.[ch]: added new enum GimpStrokeMethod which
can be one of { LIBART, PAINT_CORE }.
* app/core/Makefile.am
* app/core/core-types.h
* app/core/gimpstrokedesc.[ch]: new object which encapsulates
the params and setup logic for the different stroke methods.
* app/core/gimpitem.[ch]: use it in GimpItem::stroke() and
in the gimp_item_stroke() wrapper.
* app/core/gimpchannel.c (gimp_channel_stroke)
* app/core/gimpselection.c (gimp_selection_stroke)
* app/vectors/gimpvectors.c (gimp_vectors_stroke): changed accprdingly.
* app/actions/select-commands.c
* app/actions/vectors-commands.c
* app/dialogs/stroke-dialog.c
* tools/pdbgen/pdb/edit.pdb
* tools/pdbgen/pdb/paths.pdb: use GimpStrokeDesc. Simplifies the
code quite a bit.
* app/pdb/edit_cmds.c
* app/pdb/paths_cmds.c: regenerated.
2004-10-22 Michael Natterer <mitch@gimp.org>
* app/widgets/gimppropwidgets.c: remember the param_spec with each
radio button instead of with the box/frame around them.
2004-10-21 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/script-fu.c: Removed _() tag from two strings
that should not have been marked for translation.
2004-10-21 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts-fu.c: Fixed spelling error.
2004-10-21 Michael Natterer <mitch@gimp.org>
* app/actions/select-actions.c
* app/actions/select-commands.[ch]
* app/actions/vectors-actions.c
* app/actions/vectors-commands.[ch]: added actions and callbacks
to stroke with the last values used without showing the stroke
dialog. The actions have no menu entries but can be called via
shortcuts. Fixes bug #135746.
(Disclaimer: the uglyness of the callbacks shows the need for a
stroke API overhaul).
2004-10-20 Michael Natterer <mitch@gimp.org>
* app/core/gimpdrawable-stroke.c
(gimp_drawable_stroke_scan_convert): Replacing the call to
gimp_channel_is_empty() by a simple gimp_drawable_mask_intersect()
was wrong because gimp_channel_is_empty() makes sure that the
selection doesn't mask itself while being stroked.
2004-10-20 Michael Natterer <mitch@gimp.org>
* plug-ins/common/raw.c: ported to GimpPreviewArea.
2004-10-20 Michael Natterer <mitch@gimp.org>
* plug-ins/common/raw.c: new plug-in from Tim Copperfield, made
work with the GIMP 2.1 API by Philipp Gühring, then heavily
cleaned up and undeprecated by myself. Fixes bug #144943.
(still uses GtkPreview, but i wanted a sane state in cvs to diff
against before replacing it)
* plug-ins/common/plugin-defs.pl: changed accordingly.
* plug-ins/common/Makefile.am: regenerated.
2004-10-20 Michael Natterer <mitch@gimp.org>
Fixed bug #155733 for libgimp:
* tools/pdbgen/pdb/drawable.pdb: export drawable_mask_intersect()
to the PDB and improved documentation for drawable_mask_bounds().
* app/pdb/drawable_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpdrawable_pdb.[ch]: regenerated.
* libgimp/gimp.def: changed accordingly.
2004-10-20 Michael Natterer <mitch@gimp.org>
* app/core/gimpdrawable.[ch]: added gimp_drawable_mask_intersect()
which returns the same bounding box as gimp_drawable_mask_bounds(),
but returns TRUE only if there is a non-empty intersection between
the drawable and the selection, or no selection at all. It also
returns the intersection as x,y,width,height instead of the
eeky x1,y1,x2,y2.
* app/core/gimp-edit.c
* app/core/gimpdrawable-blend.c
* app/core/gimpdrawable-bucket-fill.c
* app/core/gimpdrawable-desaturate.c
* app/core/gimpdrawable-equalize.c
* app/core/gimpdrawable-histogram.c
* app/core/gimpdrawable-invert.c
* app/core/gimpdrawable-stroke.c
* app/core/gimpimagemap.c
* app/core/gimpselection.c
* tools/pdbgen/pdb/color.pdb
* tools/pdbgen/pdb/transform_tools.pdb: either switch from
gimp_drawable_mask_bounds() to _intersect() or check the return
values of _mask_bounds() manually to avoid operations on empty
areas. Return successfully because it's a nop, not a failure.
Fixes bug #155733 for the core.
* app/pdb/color_cmds.c
* app/pdb/transform_tools_cmds.c: regenerated.
2004-10-19 Michael Natterer <mitch@gimp.org>
* app/tools/gimptextoptions.c (gimp_text_options_gui): removed
3 mnemonics. No other tool options label has a mnemonic.
Addresses bug #155861.
2004-10-19 Michael Natterer <mitch@gimp.org>
* app/dialogs/Makefile.am
* app/dialogs/vectors-options-dialog.[ch]: one more dialog split
out of actions/.
* app/actions/vectors-commands.c: removed it here. Merged more
utility functions into their only callers.
* app/actions/dockable-commands.c
* app/actions/edit-commands.c
* app/actions/file-commands.c
* app/actions/palettes-commands.c
* app/actions/tool-options-commands.c
* app/actions/view-commands.c: renamed "qbox" and "query_box"
variables to "dialog".
2004-10-19 Michael Natterer <mitch@gimp.org>
* plug-ins/common/screenshot.c (shoot_dialog): don't forget to set
the mnemonic widgets for the labels. Fixes bug #155811.
2004-10-19 Michael Natterer <mitch@gimp.org>
* app/dialogs/Makefile.am
* app/dialogs/channel-options-dialog.[ch]: new files implementing
the channel options dialog with a horrid number of 13 construction
parameters. Still better than having the same code twice, only
differing in strings used...
* app/actions/channels-commands.c
* app/actions/qmask-commands.c: removed the dialog code here and
use channel_options_dialog_new().
2004-10-19 Jay Cox <jaycox@gimp.org>
* plug-ins/common/psd_save.c: don't try to save psd files that are
larger than 30000 pixels in either direction. Fixed the rle code
to compress more compactly. Fixed a memmory leak in
save_channel_data.
2004-10-18 Michael Natterer <mitch@gimp.org>
Action code review and pre-release consistency cleanup:
* app/actions/*-actions.c: added some missing and resolved
conflicting mnemonics, added missing help IDs. Cleaned up the
*_actions_update() functions.
* app/actions/channels-actions.c
* app/actions/layers-actions.c
* app/actions/vectors-actions.c (*_actions_update): simplified
the code that figures the prev and next channel,layer,vectors.
* app/actions/qmask-actions.c: use the same accelerator for
"qmask-active" and "qmask-toggle". Fixed action sensitivity.
* app/actions/channels-commands.c
* app/actions/dockable-commands.c
* app/actions/documents-commands.c
* app/actions/gradients-commands.c
* app/actions/layers-commands.c
* app/actions/palettes-commands.c
* app/actions/image-commands.c
* app/actions/select-commands.c
* app/actions/vectors-commands.c: folded tons of private utility
functions into their only callers (they used to be public and
called from outside before the switch to action based menus).
Renamed functions and variables saying "query" or "qbox" to
"dialog". Moved static functions to the end of the files. Misc
minor cleanups.
* app/actions/drawable-actions.c
* app/actions/drawable-commands.c: made the "drawable-visible" and
"drawable-linked" actions affect the layer if the active drawable
is a layer mask.
* app/actions/select-commands.c: added action to stroke with the
last values used in an attempt to address bug #135746 but #if 0'ed
it because the approach is too ugly.
* app/tools/gimpiscissorstool.c: changed mnemonic from I to S.
* menus/image-menu-xml.in: added more stuff to the (commented out)
"context" menu.
2004-10-17 DindinX <dindinx@gimp.org>
* libgimp/gimppixelrgn.c: some more clues in the documentation
(suggested by nomis)
2004-10-17 DindinX <dindinx@gimp.org>
* libgimp/gimppixelrgn.c: clarify some usecases for
gimp_pixel_rgn_init().
2004-10-17 DindinX <dindinx@gimp.org>
* plug-ins/common/colortoalpha.c: Added a preview.
2004-10-17 DindinX <dindinx@gimp.org>
* plug-ins/common/glasstile.c: use a GimpDrawablePreview.
2004-10-17 DindinX <dindinx@gimp.org>
* plug-ins/common/borderaverage.c: smallish cleanups.
2004-10-17 DindinX <dindinx@gimp.org>
* plug-ins/common/displace.c: Added a preview and minor cleanups.
Can someone provide useful testcases for this plug-in?
2004-10-16 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpitemtreeview.[ch]: moved "item_type" and
"signal_name" from GimpItemTreeView to GimpItemTreeViewClass.
Removed them from gimp_item_tree_view_new(). Require the view_type
instead of item_type in gimp_item_tree_view_new().
* app/widgets/gimpitemtreeview.c
* app/widgets/gimpdrawabletreeview.c (get_type): made them
abstract base classes.
* app/widgets/gimpchanneltreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpvectorstreeview.c (class_init): set the
item_type and signal_name members if GimpItemTreeViewClass.
* app/dialogs/dialogs-constructors.c: changed accordingly.
2004-10-16 Manish Singh <yosh@gimp.org>
* autogen.sh: Add support for automake 1.9. Also rm autom4te.cache,
since it might interfere with differing autoconf versions.
2004-10-16 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpuimanager.[ch]: added utility function
gimp_ui_manager_get_action() which takes "group_name" and
"action_name".
* app/display/gimpdisplayshell-close.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimptoolbox.c
* app/widgets/gimptooloptionseditor.c: use it.
2004-10-16 Michael Natterer <mitch@gimp.org>
* app/actions/channels-actions.c
* app/actions/colormap-editor-actions.c
* app/actions/documents-actions.c
* app/actions/tool-options-actions.c
* app/actions/vectors-actions.c: added more tooltips for actions
which are used as extended dialog button callbacks.
* app/widgets/gimpeditor.c (gimp_editor_add_action_button): keep
the list of extended actions in reverse order.
* app/widgets/gimpchanneltreeview.c
* app/widgets/gimpcolormapeditor.c
* app/widgets/gimpdocumentview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpvectorstreeview.c: don't set the tooltips
manually. Removes another bunch of insane translatable multiline
format strings. Pass the extended actions in the right order
to gimp_editor_add_action_button().
2004-10-16 Michael Natterer <mitch@gimp.org>
* app/actions/vectors-commands.c (vectors_linked_cmd_callback):
call gimp_item_set_linked(), not gimp_item_set_visible().
Fixes bug #155578
2004-10-16 Michael Natterer <mitch@gimp.org>
Ported the layers, channels and paths dialogs from
gimp_editor_add_button() to gimp_editor_add_action_button(),
removing a massive amount of duplicated code, sensitivity logic
and confusing utility functions.
* app/actions/channels-actions.c
* app/actions/channels-commands.[ch]
* app/actions/layers-actions.c
* app/actions/layers-commands.[ch]
* app/actions/vectors-actions.c
* app/actions/vectors-commands.[ch]: added "foo-new-default"
actions and callbacks which create items without a dialog,
optionally using default values from a passed template. Removed
all public utility function that were passed as function pointers
to widget construtors. Added tooltips to all actions which are now
used for dialog buttons.
* app/widgets/gimpeditor.c (gimp_editor_add_action_button):
automatically create multi-line tooltips showing the modifiers for
extended action buttons. Removes the need for lots of insane
format strings that need to be translated correctly.
* app/widgets/gimpitemtreeview.[ch] (struct GimpItemTreeViewClass):
replaced tooltip and help_id strings by action names.
(struct GimpItemTreeView)
(gimp_item_tree_view_new): removed "edit", "new" and "activate"
function pointers.
(gimp_item_tree_view_constructor): create all buttons
with gimp_editor_add_action_button(), using the action names
from GimpItemTreeViewClass.
Removed tons of "clicked" callbacks and all code which sets the
buttons' sensitivity. They are not needed any longer.
Require all subclasses to implement GimpItemTreeView::new_item(),
a new virtual function which creates a plain new item without
showing a dialog.
* app/widgets/gimpdrawabletreeview.c
* app/widgets/gimpchanneltreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpvectorstreeview.c: fill in the action names and
implement GimpItemTreeView::new_item(). Removed all button
sensitivity logic.
* app/dialogs/dialogs-constructors.c: changed accordingly. Doesn't
include anything from actions/ any more.
2004-10-15 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/layer.pdb: fixed parameter descriptions for
layer_add_mask() and layer_remove_mask().
* app/pdb/layer_cmds.c
* libgimp/gimplayer_pdb.c: regenerated.
2004-10-15 Michael Natterer <mitch@gimp.org>
* app/actions/images-commands.[ch]
* app/actions/templates-commands.[ch]: made some public functions
private or removed them entirely by folding their code into their
callers. They used to be passed as function pointers to widgets in
the pre action-based dialog buttons era.
2004-10-15 Michael Natterer <mitch@gimp.org>
* app/dialogs/quit-dialog.c: raise the image's displays on
double-click in the dirty image list.
2004-10-15 Michael Natterer <mitch@gimp.org>
Fixed bug #155328:
* app/actions/vectors-actions.c (vectors_actions_update): don't
set the "selection to path" actions sensitive if there is no
image.
* app/widgets/gimpitemtreeview.c: update the UI manager after
setting the view's image. Connect to GimpImage::flush() and
update the UI manager in the callback, too.
2004-10-15 Michael Natterer <mitch@gimp.org>
* app/actions/view-actions.c (view_zoom_actions): removed
duplicate "view-zoom-in" action (cut'n'paste error) and fixed the
swapped "zoom in/out a lot" actions. Fixes bug #155446.
2004-10-15 Sven Neumann <sven@gimp.org>
* Made 2.1.7 release.
2004-10-15 Sven Neumann <sven@gimp.org>
* app/tools/gimptransformoptions.c: removed the "Density" label.
It wasn't helpful and caused the transform options to be wider than
necessary.
* app/tools/gimpblendoptions.c
* app/tools/gimppaintoptions-gui.c
* app/tools/gimptransformoptions.c: let combo boxes expand
horizontally like we do in other (all?) dialogs.
* app/widgets/gimptemplateeditor.c
(gimp_template_editor_aspect_callback): update the pixel size label.
2004-10-15 Sven Neumann <sven@gimp.org>
* data/images/gimp-splash.png: new splash by Jimmac.
2004-10-15 DindinX <dindinx@gimp.org>
* plug-ins/common/scatter_hsv.c: ported to GimpDrawablePreview, and
removed many lines of codes.
2004-10-14 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/neon.scm: Fixed minor error in script.
(Related to bug #153900 and compatability with Tiny-Fu)
2004-10-14 DindinX <dindinx@gimp.org>
* plug-ins/common/neon.c: fixed the handling of drawable with alpha.
2004-10-14 DindinX <dindinx@gimp.org>
* plug-ins/common/nlfilt.c: Ported to GimpDrawablePreview, the
previous preview was absolutely useless. Done some cleanups, too.
* plug-ins/common/spread.c: remember the preview state between
invocations.
2004-10-14 DindinX <dindinx@gimp.org>
* plug-ins/common/emboss.c: use a GimpDrawablePreview instead of a
GimpAspectPreview, since this plug-in is somewhat edge-oriented and
this makes the code simpler ;)
2004-10-14 Michael Natterer <mitch@gimp.org>
* themes/Default/images/stock-gradient-bilinear-16.png
* themes/Default/images/stock-gradient-linear-16.png: rotate them
by 90 degrees. All our gradient previews and icons go left->right,
not top->bottom.
2004-10-14 Manish Singh <yosh@gimp.org>
* plug-ins/common/bmpread.c: Make sure we have a bpp value we can
handle, and fail gracefully if not. Fixes bug #155401.
2004-10-14 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpwidgets.c
* app/widgets/gimpenumwidgets.[ch]
* app/widgets/gimppropwidgets.c
* app/actions/layers-commands.c
* app/dialogs/convert-dialog.c
* app/tools/gimpblendoptions.c
* app/tools/gimpbucketfilloptions.c
* app/tools/gimpcolorbalancetool.c
* app/tools/gimpcolorizetool.c
* app/tools/gimpcoloroptions.c
* app/tools/gimpcurvestool.c
* app/tools/gimphuesaturationtool.c
* app/tools/gimpinkoptions-gui.c
* app/tools/gimplevelstool.c
* app/tools/gimppaintoptions-gui.c
* app/tools/gimpselectionoptions.c
* app/tools/gimptransformoptions.c: the child of a GimpFrame must
not have any border width. Fixes many subtle misalignments.
2004-10-14 Sven Neumann <sven@gimp.org>
* app/core/gimpprogress.[ch]: added "message" function to the
GimpProgress interface. Call gimp_message() if it is unimplemented.
* app/plug-in/plug-in-progress.[ch]: added new function
plug_in_progress_message() that passes the message to the current
proc_frame's progress.
* app/widgets/gimpthumbbox.c: implement GimpProgress::message.
Just do nothing in the implementation. We don't want to see
messages from file plug-ins that we use to create the thumbnails.
* tools/pdbgen/pdb/message.pdb
* app/pdb/message_cmds.c: if there's a current plug-in, dispatch
the message by calling plug_in_progress_message().
* app/display/gimpdisplayshell-close.c: fixed wrong types in
function calls.
2004-10-14 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcolordialog.c (gimp_color_dialog_new): use
GIMP_HELP_COLOR_DIALOG as help_id.
2004-10-14 Michael Natterer <mitch@gimp.org>
* app/actions/dialogs-commands.c: purely cosmetic.
2004-10-14 Michael Natterer <mitch@gimp.org>
* app/core/core-enums.[ch]: register GimpConvertPaletteType with
the type system.
* tools/pdbgen/enums.pl: regenerated.
* app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
fixed to insert the widget at the right place in the radio box.
* app/dialogs/convert-dialog.c: use enum widgets and
gimp_enum_radio_frame_add(), resulting in a much better looking
dialog with much less lines of code.
2004-10-14 Sven Neumann <sven@gimp.org>
* plug-ins/helpbrowser/dialog.c: changed "Home" button to "Index".
"Home" is misleading and leads to problems in some locales (see
bug #148120).
2004-10-14 Michael Natterer <mitch@gimp.org>
* tools/authorsgen/contributors: correct UTF-8 spelling of
João S. O. Bueno Calligaris.
* AUTHORS
* app/dialogs/authors.h: regenerated.
2004-10-14 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/circuit.scm: Fixed to allow use of
script on original layer. (bug #155358) Fixed spelling error.
2004-10-13 Manish Singh <yosh@gimp.org>
* tools/pdbgen/Makefile.am: Remove stamp files during
maintainer-clean. Addresses bug #155357. Also flesh out the
dependencies some so rebuilds get triggered when all their
dependent files change.
2004-10-14 Sven Neumann <sven@gimp.org>
* app/actions/file-commands.c (file_revert_cmd_callback): creata
an UTF-8 filename from the image URI and display that instead of
the URI.
* app/dialogs/convert-dialog.c (convert_dialog_new): removed the
palette size warning for transparent images. The number of colors
is already adjusted to 255. This text was IMO more frightening
than helpful.
2004-10-13 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/add-bevel.scm: two variables were
not defined before first use (bug #153900).
2004-10-13 Kevin Cozens <kcozens@cvs.gimp.org>
* app/widgets/gimpactionview.c: Fixed a spelling error.
2004-10-13 DindinX <dindinx@gimp.org>
* plug-ins/common/colorify.c: Added a preview.
2004-10-13 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.c: removed trailing whitespace.
* libgimpwidgets/gimpwidgets.def: added
gimp_preview_set_default_cursor.
2004-10-13 Sven Neumann <sven@gimp.org>
* app/widgets/gimpmessagedialog.c: improved handling of parent
widget; probably just being paranoid here.
* app/actions/image-commands.c
* app/dialogs/image-new-dialog.c: ported memory size confirmation
dialogs to GimpMessageDialog.
2004-10-13 DindinX <dindinx@gimp.org>
* libgimpwidgets/gimppreview.[ch]: added a new function to set the
default cursor on preview: gimp_preview_set_default_cursor().
* libgimpwidgets/gimpscrolledpreview.c: changed accordlingly.
* plug-ins/common/flarefx.c:
* plug-ins/common/nova.c: use this function.
This addresses bug #90519.
2004-10-13 DindinX <dindinx@gimp.org>
* plug-ins/common/cubism.c: Added a preview and done some cleanups.
2004-10-13 Sven Neumann <sven@gimp.org>
* app/actions/plug-in-commands.c
* app/actions/templates-commands.c
* app/actions/tool-options-commands.c: ported more boolean queries
to GimpMessageDialog.
2004-10-13 Sven Neumann <sven@gimp.org>
* app/widgets/gimpmessagedialog.c: handle parent widget not being
a GtkWindow by calling gtk_widget_get_toplevel().
* app/actions/data-commands.c
* app/actions/edit-commands.c
* app/actions/file-commands.c: ported more boolean queries to
GimpMessageDialog.
2004-10-13 Sven Neumann <sven@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpmessagedialog.[ch]: added a simple message
dialog to avoid code duplication.
* app/widgets/gimpmessagebox.c: set the border width to 12 pixels.
* app/dialogs/file-save-dialog.c
* app/dialogs/quit-dialog.c
* app/display/gimpdisplayshell-close.c
* app/widgets/gimperrordialog.c
* app/widgets/gimphelp.c
* app/widgets/gimpactionview.c: use the new GimpMessageDialog.
2004-10-13 Michael Natterer <mitch@gimp.org>
* app/actions/image-actions.c
* menus/image-menu.xml.in: added menu branch "<Image>/Image/Guides".
* plug-ins/script-fu/scripts/Makefile.am
* plug-ins/script-fu/scripts/guides-from-selection.scm
* plug-ins/script-fu/scripts/guides-new-percent.scm
* plug-ins/script-fu/scripts/guides-new.scm
* plug-ins/script-fu/scripts/guides-remove-all.scm: added new
scripts from Alan Horkan. Fixes bug #119667.
2004-10-13 Michael Natterer <mitch@gimp.org>
* plug-ins/common/flarefx.c: cleaned up and simplified the
FlareCenter code even more.
* plug-ins/common/nova.c: did the same changes for the NovaCenter
stuff.
Also added code which sets an appropriate cursor on "realize" to
fix bug #90519, but GimpPreview currently prevents this from
working correctly...
2004-10-13 Sven Neumann <sven@gimp.org>
* app/widgets/widgets-enums.[ch]: changed the description for
GIMP_HELP_BROWSER_GIMP.
* app/dialogs/file-save-dialog.c:
* app/widgets/gimphelp.c: use a GimpDialog embedding a
GimpMessageBox instead of gimp_query_boolean_box which looks
somewhat old fashioned.
2004-10-13 Sven Neumann <sven@gimp.org>
* app/widgets/gimphelp.c: improved error messages on missing help
browser plug-in.
* libgimpthumb/gimpthumb-utils.c
* libgimpthumb/gimpthumbnail.c: improved documentation.
2004-10-13 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-close.c
(gimp_display_shell_close_dialog): changed button label.
2004-10-12 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/asc2img.scm: Fixed error in name of
script used in second register line.
2004-10-13 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-close.c: changed rounding.
2004-10-13 Michael Natterer <mitch@gimp.org>
* app/dialogs/image-new-dialog.c (image_new_response): don't
forget to reset the template combo on RESPONSE_RESET.
2004-10-13 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplay-foreach.c: keep the container of dirty
images up to date.
* app/dialogs/quit-dialog.c: fixed model/view behavior here, too.
(both are still far from perfect)
2004-10-13 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-close.c
(gimp_display_shell_close_dialog): keep the time uptodate.
2004-10-13 Sven Neumann <sven@gimp.org>
* app/core/gimpimagefile.c (gimp_imagefile_create_thumbnail): ref
the imagefile while creating the thumbnail.
* app/core/gimpimagefile.[ch]
* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): moved
the tricky part about thumbnail creation into the new function
gimp_imagefile_create_thumbnail_weak().
2004-10-13 Michael Natterer <mitch@gimp.org>
* plug-ins/pagecurl/pagecurl.c: forgot to remove N_() from
gimp_plugin_menu_register().
2004-10-13 Michael Natterer <mitch@gimp.org>
* app/dialogs/preferences-dialog.c (prefs_dialog_new): added
missing and resolved conflicting mnemonics.
2004-10-12 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/selection-round.scm: moved out of the
"Modify" placeholder. Using placeholders from Script-Fu breaks
i18n. We will need to change menu registration for scripts but
this will have to wait..
2004-10-12 Michael Natterer <mitch@gimp.org>
* plug-ins/*/*.c: all plug-ins except script-fu: removed the
translation marks from the menu paths passed to
gimp_plugin_menu_register(). All default menu branches used by
included plug-ins are created and translated by the core now.
2004-10-12 Sven Neumann <sven@gimp.org>
* app/core/gimpimage.[ch]: renamed struct member "unit" to
"resolution_unit".
* app/actions/image-commands.c
* app/core/gimp-edit.c
* app/core/gimpimage-duplicate.c
* app/core/gimpimage-undo-push.c
* app/dialogs/info-window.c
* app/vectors/gimpvectors-export.c
* app/widgets/gimptoolbox-dnd.c:
* app/xcf/xcf-load.c
* app/xcf/xcf-save.c: changed accordingly. Use gimp_image_get_unit()
where appropriate.
* app/core/gimptemplate.c (gimp_template_set_from_image): fixed
unit handling. Don't touch the template unit, it is used as the
initial display unit. This will need further changes...
2004-10-12 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
need to pack the widget expanding. Fixes pattern container
entries.
2004-10-12 Sven Neumann <sven@gimp.org>
* app/dialogs/info-window.[ch]: fixed unit handling. Right-align
the labels displaying the cursor position. Renamed the "Extended"
tab to "Cursor". Renamed the API accordingly.
* app/display/gimpdisplayshell-cursor.c: changed accordingly.
2004-10-12 Michael Natterer <mitch@gimp.org>
* app/actions/drawable-commands.c (drawable_rotate_cmd_callback):
if the drawable is a channel, pass clip_result as FALSE. Need to
do this here for rotating only because it can't be decided
generically in GimpChannel. Fixes crash when rotating channels
or layer masks.
Use the undo_desc from GimpItemClass instead of passing "Flip
Layer" and "Rotate Layer".
2004-10-12 Sven Neumann <sven@gimp.org>
* app/file/file-open.c: minor cleanup.
* app/file/file-save.c (file_save_as): no need to fiddle with the
image name, the URI is taken from the imagefile anyway.
2004-10-12 Sven Neumann <sven@gimp.org>
* app/actions/layers-actions.c (layers_actions_update): set
"layers-crop" insensitive if the selection is empty.
* plug-ins/script-fu/scripts/alien-glow-button.scm
* plug-ins/script-fu/scripts/alien-glow-logo.scm
* plug-ins/script-fu/scripts/basic2-logo.scm
* plug-ins/script-fu/scripts/gradient-bevel-logo.scm: use "Sans
Bold" instead of "Futura_Poster". The underscore in the font name
used to confuse intltool (bug #137029) and the freefont package
isn't that widely used any longer anyway.
2004-10-12 Sven Neumann <sven@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox.
* app/widgets/gimppropwidgets.c: the order of setting the X and Y
properties does matter.
* app/dialogs/Makefile.am
* app/dialogs/scale-dialog.[ch]: added first version of a new
Scale dialog in an attempt to address bug #151022.
* app/actions/layers-commands.c: use the new scale dialog.
2004-10-12 Sven Neumann <sven@gimp.org>
* app/widgets/gimptemplateeditor.c: added mnemonics for the size
entries.
2004-10-12 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned):
instead of simply using the passed widget as mnemonic_widget for
the GtkLabel, call the new utility function find_mnemonic_widget()
which recursively searches the passed widget until it finds one
that actually can be mnemonic-activated. Fixes lots of mnemonics
where the attached widget is e.g. a GtkEventBox or GtkComboBox.
2004-10-12 Michael Natterer <mitch@gimp.org>
* app/tools/gimptooloptions-gui.[ch]: removed the recently added
utility functions again.
* app/widgets/Makefile.am
* app/widgets/gimpviewablebox.[ch]
* app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
versions here.
* app/tools/gimpbucketfilloptions.c
* app/tools/gimpclonetool.c
* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c: changed accordingly.
* app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
of reinventing the wheel.
2004-10-12 Sven Neumann <sven@gimp.org>
* app/widgets/gimpaction.c (gimp_action_set_proxy): use a larger
icon size for GimpImagefile views.
* themes/Default/images/stock-frame-64.png: removed the 1 pixel
wide empty border around the frame.
* app/widgets/gimpviewrenderer-frame.c: adjusted the hardcoded values.
2004-10-12 Sven Neumann <sven@gimp.org>
* Makefile.am: defined DISTCHECK_CONFIGURE_FLAGS with the
configure options that are needed to run 'make dist'.
2004-10-12 Sven Neumann <sven@gimp.org>
* app/widgets/gimptemplateeditor.c: tweaked table spacings to get
the Height label aligned with the entry again.
2004-10-12 Sven Neumann <sven@gimp.org>
* app/widgets/gimpprogressdialog.c (gimp_progress_dialog_new): set
the "skip_taskbar_hint" and "skip_pager_hint" properties on the
progress window.
2004-10-11 Manish Singh <yosh@gimp.org>
* plug-ins/fp/fp.c: Moved from here...
* plug-ins/common/fp.c: ... to here.
* plug-ins/common/plugin-defs.pl: changed accordingly.
* plug-ins/common/.cvsignore
* plug-ins/common/Makefile.am: regenerated.
* configure.in
* plug-ins/Makefile.am
* plug-ins/fp: Removed directory.
2004-10-11 DindinX <dindinx@gimp.org>
* plug-ins/common/jigsaw.c: ported to GimpAspectPreview.
2004-10-11 Michael Natterer <mitch@gimp.org>
* plug-ins/common/flarefx.c: use a GimpSizeEntry for specifying
the flare center. Fixed flare center dragging. Lots of cleanup.
2004-10-11 Michael Natterer <mitch@gimp.org>
* app/dialogs/dialogs-types.h: removed ColorDialog typedef.
2004-10-11 Michael Natterer <mitch@gimp.org>
* app/tools/gimptooloptions-gui.[ch]: added utility functions
which create a GimpViewableButton+GimpContainerEntry combo for
brushes, patterns, gradients and fonts and a very ugly utility
function which packs one of these combos into a GtkFrame returned
by gimp_prop_enum_radio_frame_new(). This stuff does not really
belong here but is too ugly to be moved to a more general place.
* app/tools/gimpbucketfilloptions.c
* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c: use the new utility functions. Moved
the pattern previews into the radio frame where using the pattern
is selected. Make them insensitive if using the pattern is not
selected.
2004-10-11 Sven Neumann <sven@gimp.org>
* app/config/gimprc-blurbs.h: tweaked the thumbnail related blurbs.
* app/dialogs/preferences-dialog.c: group the thumbnail related
controls together. Could probably still be improved...
2004-10-11 Sven Neumann <sven@gimp.org>
* app/actions/documents-commands.c
(documents_recreate_preview_cmd_callback): when recreating the
thumbnail, delete old thumbnails and create it in the configured
thumbnail size instead of the container view preview size.
* libgimpthumb/gimpthumbnail.c (gimp_thumbnail_update_thumb):
reset the image info when the thumbnail state changes.
2004-10-11 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfiledialog.c: construct a case-insensitive glob
pattern to use when filtering for file extensions.
2004-10-11 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
user-visible counting starts at 1, not 0.
2004-10-11 Michael Natterer <mitch@gimp.org>
* tools/authorsgen/contributors: added missing contributors.
Thanks to Kevin Cozens for going through ChangeLog and making a list.
* AUTHORS
* app/dialogs/authors.h: regenerated.
2004-10-11 Sven Neumann <sven@gimp.org>
* libgimpthumb/gimpthumbnail.c: ooops, forgot to disable the debug
output again.
2004-10-11 Sven Neumann <sven@gimp.org>
* app/batch.c: clarified.
2004-10-08 Kevin Cozens <kcozens@cvs.gimp.org>
* configure.in: removed duplicate GETTEXT_PACKAGE line.
2004-10-11 Sven Neumann <sven@gimp.org>
* libgimpthumb/gimpthumb-utils.[ch]
* libgimpthumb/gimpthumb.def: added an API to delete thumbnails.
* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnail):
when recreating a thumbnail on user request, delete all existing
thumbnails for it.
* plug-ins/common/AlienMap2.c: removed unused variable.
2004-10-10 Sven Neumann <sven@gimp.org>
* libgimpthumb/gimpthumb-utils.[ch]
* libgimpthumb/gimpthumb.def
* libgimpthumb/gimpthumbnail.c: added support for local thumbnails
as introduced by version 0.7 of the thumbnail spec. Untested, but
at least the API is there.
2004-10-10 DindinX <dindinx@gimp.org>
* plug-ins/common/AlienMap2.c: ported to GimpAspectPreview, and some
minor cleanups.
2004-10-10 DindinX <dindinx@gimp.org>
* plug-ins/common/vpropagate.c: added a preview.
2004-10-10 DindinX <dindinx@gimp.org>
* plug-ins/common/flarefx.c
* plug-ins/common/waves.c: cleanups and ported to GimpAspectPreview.
2004-10-10 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcontainerview.c (gimp_container_view_lookup):
handle NULL as viewable parameter as a workaround for bug #149906.
* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): made
the code more robust.
* app/xcf/xcf-private.h
* app/xcf/xcf.c: added a const qualifier.
2004-10-09 DindinX <dindinx@gimp.org>
* app/dialogs/dialogs.h: fixed a typo in the double-inclusion guard.
2004-10-09 Sven Neumann <sven@gimp.org>
* AUTHORS
* app/dialogs/authors.h: regenerated. Someone should look into
updating the list of contributors for the 2.2 release ...
2004-10-08 Kevin Cozens <kcozens@cvs.gimp.org>
* tools/authorsgen/contributors: Added my name to the
list of contributors.
2004-10-08 Sven Neumann <sven@gimp.org>
* app/widgets/gimpthumbbox.c: tweaked the text shown while
updating the preview so that the dialog doesn't need to resize.
2004-10-08 Sven Neumann <sven@gimp.org>
* app/config/gimpcoreconfig.[ch]
* app/config/gimprc-blurbs.h: added new gimprc option
"thumbnail-filesize-limit" that allows to control the maximum
filesize for automatic thumbnail creation.
* app/dialogs/preferences-dialog.c: added a GUI for it, needs
review.
* app/core/gimpimagefile.[ch]: minor cleanups. Moved call to
gimp_thumbnail_peek_image() from gimp_imagefile_save_thumb() to
gimp_imagefile_save_thumbnail() to avoid it being called twice.
* app/file/file-utils.[ch]: export utility function
file_utils_find_proc_by_extension() that allows to check for a
file plug-in by looking at the filename extension only.
* app/widgets/gimpthumbbox.[ch]: automatically create or update
thumbnails for image files with a known extension that are smaller
than "thumbnail-filesize-limit". Fixes bug #137176.
2004-10-08 Sven Neumann <sven@gimp.org>
* plug-ins/common/ripple.c: handle the tile parameter identically
for preview and final result. Set Edges options insensitive when
"Retain tileability" is checked. Reported by Olivier.
2004-10-08 Sven Neumann <sven@gimp.org>
* plug-ins/common/apply_lens.c (lens_dialog): invalidate the
preview when the toggle buttons are used. Reported by Olivier.
* app/widgets/gimpview.c: minor cleanup.
2004-10-08 Michael Natterer <mitch@gimp.org>
* app/tools/gimpmeasuretool.c: implement GimpTool::key_press() and
cancel the tool on GDK_Escape. Come cleanup.
2004-10-08 Michael Natterer <mitch@gimp.org>
Made the text options about two toolbox grid columns smaller.
Addresses bug #122862.
* app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use
the number of digits of the property's max_val plus two as number
of chars for the sizeentry'y spinbutton (instead of always 10 as
before).
* app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry
has a minimal width of 150 pixels (eek). Set a silly small minimal
width instead (the entry expands to the available width anyway).
2004-10-08 Sven Neumann <sven@gimp.org>
* app/file/file-utils.c: added lots of const qualifiers.
2004-10-08 Michael Natterer <mitch@gimp.org>
* app/tools/gimppaintoptions-gui.c: the gradient button in blend
options got lost, added it back. Also moved creation of the brush,
pattern and gradient buttons to utility functions and cleaned up
the whole file a bit.
2004-10-08 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell.c (gimp_display_shell_real_scaled)
(gimp_display_shell_flush)
* app/gui/gui-vtable.c (gui_display_create): always pass a
GimpDisplay, not a GimpDisplayShell as "data" to
gimp_ui_manager_update().
* app/actions/actions.c (action_data_get_*): removed checks if the
passed data is a GimpDisplayShell and temporarily added g_assert()
to be sure. The assertions will be removed before 2.2.
2004-10-07 Sven Neumann <sven@gimp.org>
* libgimpthumb/gimpthumbnail.c: added some (disabled) debug output.
* app/widgets/gimpviewrenderer-frame.[ch]: added a way to retrieve
the size of the frame borders.
* app/widgets/gimpthumbbox.c: don't set an arbitrary padding but
exactly the size of the frame borders. Otherwise we get large
thumbnails (scaled down) if we request normal sized ones.
2004-10-07 Kevin Cozens <kcozens@cvs.gimp.org>
* plug-ins/script-fu/scripts/selection-round.scm: Changed deprecated
constant ADD to CHANNEL-OP-ADD.
2004-10-07 Michael Natterer <mitch@gimp.org>
Merged the gz and bz2 plug-ins into one generic compression
handler that can be extended by adding entries to a table of
compressor definitions:
* configure.in: removed bz2 special casing for win32.
* plug-ins/common/bz2.c
* plug-ins/common/gz.c: removed.
* plug-ins/common/compressor.c: new plug-in.
* plug-ins/common/plugin-defs.pl: changed accordingly.
* plug-ins/common/.cvsignore
* plug-ins/common/Makefile.am: regenerated.
2004-10-07 Simon Budig <simon@gimp.org>
* app/actions/view-commands.c: fill in the formula... :-)
untabbified.
* app/display/gimpdisplayshell-scale.c: Micro-Cleanup, untabbified.
2004-10-07 Michael Natterer <mitch@gimp.org>
* app/actions/view-actions.c: changed zoom actions to be
GimpEnumActions using the GimpActionSelectType enum. Enables
keyboard shortcuts for useless stuff like "zoom out a lot", and
makes them better accessible for external controllers.
* app/actions/view-commands.[ch]: renamed view_zoom_cmd_callback()
to view_zoom_explicit_cmd_callback(), removed the zoom_in and
zoom_out callbacks and added a new view_zoom_cmd_callback() for
the new GimpActionSelectType-based actions. The implementation of
the new zoom types is questionable but now there is a place where
nomis can fill in nice formulas...
2004-10-06 Michael Natterer <mitch@gimp.org>
* app/tools/gimpeditselectiontool.[ch]: added new parameter
"gboolean propagate_release" to gimp_edit_slection_tool_start()
and remember it in the GimpEditSelectionTool struct. If requested,
propagate GimpTool::button_release() to the tool below in the tool
stack.
* app/tools/gimpselectiontool.c (gimp_selection_tool_start_edit):
pass FALSE so we don't get the button_release().
* app/tools/gimpmovetool.[ch]: pass TRUE so we get
button_release(). If moving a layer or path in "pick active" mode,
remember the old active layer/path and switch back to it in
button_release(). Fixes bug #97734.
Unrelated:
* app/tools/gimpeditselectiontool.c
(gimp_edit_selection_tool_motion): set "first_move" to FALSE only
if a move actually happened. Fixes un-undoable moves at high zoom
factors.
2004-10-06 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdnd.c (gimp_dnd_data_drag_begin): remember for
which GdkDragContext the icon_widget was made.
(gimp_dnd_data_drag_end): destroy the icon_widget only if it was
created for this GdkDragContext. Fixes broken DND icon_widgets
when dragging the same source again while the old icon_widget is
still floating back from an unsuccessful drop. Fixes bug #139337.
2004-10-05 Manish Singh <yosh@gimp.org>
* tools/pdbgen/lib.pl: Slight cleanup of doc generating code.
2004-10-06 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/lib.pl: for deprecated procedures, create a gtk-doc
comment that contains a link to the replacement procedure and
doesn't contain redundant information.
* tools/pdbgen/pdb/text_tool.pdb: fixed names of replacement
procedures.
* libgimp/gimpbrushes.c
* libgimp/gimpgradients.c
* libgimp/gimppalettes.c
* libgimp/gimppatterns.c: made the handwritten gtk-doc comments of
deprecated procedures look like the generated ones.
* app/pdb/text_tool_cmds.c
* libgimp/gimpbrushes_pdb.c
* libgimp/gimpgradients_pdb.c
* libgimp/gimppalettes_pdb.c
* libgimp/gimppatterns_pdb.c
* libgimp/gimptexttool_pdb.c: regenerated.
2004-10-06 Michael Natterer <mitch@gimp.org>
* app/tools/gimp-tools.c (gimp_tools_restore): reset the tool
options before deserializing so they have the correct default
values. Fixes bug #120832.
* app/tools/gimpbucketfilloptions.c
* app/tools/gimpmagnifyoptions.c
* app/tools/gimpselectionoptions.c
* app/tools/gimptransformoptions.c: removed all set_defaults()
utility functions and moved their code to reset(). The change
above calls them automatically so there is no need to call them
from the GUI constructors any more.
2004-10-06 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/scripts/selection-round.scm: use a
scale_entry instead of a spinbutton, changed mnemonic from "R" to
"E", indentation.
* plug-ins/script-fu/scripts/test-sphere.scm: s/SF_BRUSH/SF-BRUSH/
in a comment.
2004-10-06 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/selection-round.scm: applied patch by
Alan Horkan that improves usability and usefulness of this script.
Did some code cleanup and added the old procedure for backward
compatibility. Fixes bug #145147.
* menus/image-menu.xml.in: renamed placeholder in Image->Select
from "Outline" to "Modify".
2004-10-06 Sven Neumann <sven@gimp.org>
* plug-ins/common/postscript.c (ps_open): tweaked error message.
2004-10-06 Michael Natterer <mitch@gimp.org>
* app/pdb/procedural_db.h (struct ProcRecord): changed new member
"deprecated" from "gboolean" to a "gchar*" which holds the name of
the replacement procedure.
* tools/pdbgen/app.pl: changed accordingly.
* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): show
the name of the replacement procedure in the warning message.
* tools/pdbgen/stddefs.pdb: added utility function
std_pdb_deprecated() which takes the name of the replacement
procedure and fills the blurb, help, author, copyright, date and
deprecated fields of the procedure definition.
* tools/pdbgen/pdb/brushes.pdb
* tools/pdbgen/pdb/gradients.pdb
* tools/pdbgen/pdb/image.pdb
* tools/pdbgen/pdb/palettes.pdb
* tools/pdbgen/pdb/patterns.pdb
* tools/pdbgen/pdb/text_tool.pdb: use it instead of duplicating
the same code and strings for all deprecated procedures.
* app/pdb/*_cmds.c
* libgimp/gimppatterns_pdb.c
* libgimp/gimptexttool_pdb.c: regenerated.
2004-10-06 Michael Natterer <mitch@gimp.org>
Fixed the scale constraints radio buttons:
* app/tools/gimptransformoptions.c (gimp_transform_options_gui):
initialize the radio group with the correct value instead of
resetting the model before creating the group.
(gimp_scale_options_constrain_callback): change the model
only if the radio button became active.
(gimp_scale_options_constrain_notify): new callback which makes
the radio buttons a real view on the model again (fixes GUI
updates on modifier press/release).
2004-10-06 Sven Neumann <sven@gimp.org>
* app/actions/plug-in-actions.c (plug_in_actions_update): an image
doesn't necessarily have a drawable. Handle the case when it doesn't.
2004-10-06 Sven Neumann <sven@gimp.org>
* app/app_procs.[ch]
* app/batch.[ch]
* app/main.c: added new command-line option "--batch-interpreter"
that allows to specify the procedure to use to process batch
commands. Removed the perl-server hack but kept Script-Fu as the
default for backward compatibility.
* docs/gimp.1.in: documented the new option.
2004-10-06 Michael Natterer <mitch@gimp.org>
* app/actions/file-commands.c (file_revert_confirm_callback):
removed the code which sets the new image on all contexts where
the old image was set...
* app/display/gimpdisplay-foreach.c (gimp_displays_reconnect):
...and added it here so it happens for all calls of this function,
also from the PDB. Fixes bug #154638.
2004-10-06 Sven Neumann <sven@gimp.org>
* libgimp/gimp.def: updated.
2004-10-06 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/brush.pdb: return the mask's bpp and the
brush's pixmap data if it has one.
* tools/pdbgen/pdb/pattern.pdb: cleaned up.
* tools/pdbgen/pdb/image.pdb: added $deprecated = 1 to deprecated
functions even if they are not exported to libgimp any more.
* app/pdb/procedural_db.h (struct ProcRecord): added member
"gboolean deprecated".
* tools/pdbgen/app.pl
* app/xcf/xcf.c: fill it accordingly.
* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): warn
not only for deprecated procedured which are in the compat hach
table, but also for procedures with deprecated flag set to TRUE.
* app/pdb/*_cmds.c
* libgimp/gimpbrush_pdb.[ch]
* libgimp/gimppattern_pdb.[ch]: regenerated.
* libgimp/gimpbrushmenu.c
* plug-ins/gfig/gfig-style.c: changed accordingly.
2004-10-05 Manish Singh <yosh@gimp.org>
* tools/pdbgen/lib.pl: Fix array return value generation when there
are more args after it.
2004-10-06 Sven Neumann <sven@gimp.org>
* configure.in: bumped version number to 2.1.7.
2004-10-06 Sven Neumann <sven@gimp.org>
* tools/pdbgen/lib.pl: put subsequent deprecated prototypes into
a single #ifndef ... #endif pair.
* libgimp/gimpbrushes_pdb.h
* libgimp/gimpgradients_pdb.h
* libgimp/gimppalettes_pdb.h
* libgimp/gimppatterns_pdb.h
* libgimp/gimptexttool_pdb.h: regenerated.
2004-10-06 Sven Neumann <sven@gimp.org>
* app/core/gimpimage.[ch]: store the time when the image is first
dirtied.
* app/display/gimpdisplayshell-close.c: tell the user what time
period of changes will be lost when the image is not saved.
2004-10-06 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/brushes.pdb (brushes_get_brush_data)
* tools/pdbgen/pdb/gradients.pdb (gradients_sample_uniform)
(gradients_sample_custom) (gradients_get_gradient_data)
* tools/pdbgen/pdb/patterns.pdb (patterns_get_pattern_data):
deprecated.
* tools/pdbgen/pdb/brush.pdb
* tools/pdbgen/pdb/gradient.pdb
* tools/pdbgen/pdb/palette.pdb
* tools/pdbgen/pdb/pattern.pdb: added replacements for the
deprecated functions. Removed the silly feature that passing NULL
as name operates on the current brush, pattern etc.
* app/pdb/brush_cmds.c
* app/pdb/brushes_cmds.c
* app/pdb/gradient_cmds.c
* app/pdb/gradients_cmds.c
* app/pdb/internal_procs.c
* app/pdb/palette_cmds.c
* app/pdb/pattern_cmds.c
* app/pdb/patterns_cmds.c
* libgimp/gimpbrush_pdb.[ch]
* libgimp/gimpbrushes_pdb.[ch]
* libgimp/gimpgradient_pdb.[ch]
* libgimp/gimpgradients_pdb.[ch]
* libgimp/gimppalette_pdb.c
* libgimp/gimppattern_pdb.[ch]
* libgimp/gimppatterns_pdb.[ch]: regenerated.
* libgimp/gimpbrushmenu.c
* libgimp/gimpgradientmenu.c
* libgimp/gimppatternmenu.c
* plug-ins/FractalExplorer/Dialogs.c
* plug-ins/common/gradmap.c
* plug-ins/common/sample_colorize.c
* plug-ins/flame/flame.c
* plug-ins/gfig/gfig-style.c
* plug-ins/gflare/gflare.c
* plug-ins/pagecurl/pagecurl.c
* plug-ins/script-fu/scripts/spyrogimp.scm: changed accordingly.
2004-10-06 Sven Neumann <sven@gimp.org>
* plug-ins/common/spheredesigner.c: improved the dialog a bit,
needs more work.
2004-10-05 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/addborder.scm: simple change to make
the script work on all image types, not only RGB.
2004-10-05 Sven Neumann <sven@gimp.org>
* Made 2.1.6 release.
2004-10-05 Sven Neumann <sven@gimp.org>
* plug-ins/helpbrowser/dialog.c: added a close button. Launch the
browser with the HTML focused.
2004-10-05 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned):
left-justify the label.
* libgimpwidgets/gimpdialog.c: if a button with GTK_RESPONSE_HELP
is being added, hide the automatically added help button.
* plug-ins/script-fu/script-fu-interface.c: five buttons are too
much for the action area. Renamed the About button to Help and
resurrected the help button in the about dialog as a way to get to
the actual help pages (pressing F1 will get you there as well).
2004-10-05 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfiledialog.c: added a help button.
2004-10-05 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
- check the number of elements of array parameters against
the actually passed array and spit a proper error message
instead of trashing the wire. Fixes bug #154266.
- g_strdup()/g_free() the proc_name so it doesn't get mungled
by convert_string().
- added missing implementation of INT16ARRAY return values.
- cleaned up STRINGARRAY value implementations to work like
all other array values.
2004-10-04 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-interface.c (script_fu_reset):
fixed reset for SF_TEXT values.
2004-10-04 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
oops, didn't meant to remove that line.
2004-10-04 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/Makefile.am (imagemap_SOURCES): removed pix-data.h.
2004-10-04 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_area):
take drawable offsets into account when masking the preview with
the selection mask.
2004-10-04 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/gimprc.pdb (gimprc_query, gimprc_set): disallow
the empty string as token. Spotted by Kevin Cozens.
* app/pdb/gimprc_cmds.c: regenerated.
2004-10-04 Sven Neumann <sven@gimp.org>
* libgimp/gimpaspectpreview.c (gimp_aspect_preview_draw_buffer):
no need to set bpp before calling gimp_drawable_get_thumbnail_data().
2004-10-04 DindinX <dindinx@gimp.org>
* libgimp/gimpaspectpreview.c: (gimp_aspect_preview_draw_buffer):
only apply the effect inside the current selection. This, together
with my previous commit fixes bug #132194.
2004-10-04 DindinX <dindinx@gimp.org>
* plug-ins/common/channel_mixer.c: Ported to GimpAspectPreview. This
addresses but not totally fixes bug #132194.
2004-10-04 Sven Neumann <sven@gimp.org>
* app/config/gimpguiconfig.[ch]
* app/config/gimprc-blurbs.h: added gimprc option "show-help-button".
* app/dialogs/preferences-dialog.c: added a GUI for it.
* app/dialogs/file-save-dialog.c
* app/dialogs/image-new-dialog.c
* app/dialogs/quit-dialog.c
* app/display/gimpdisplayshell-close.c
* app/widgets/gimphelp-ids.h: don't set help-ids on confirmation
dialogs.
* libgimpbase/gimpprotocol.[ch]
* libgimp/gimp.[ch]: added boolean "show_help_button" to the
config message.
* app/plug-in/plug-in-run.c: pass the new preference to the plug-in.
* libgimpwidgets/gimpdialog.[ch]: added new function that allows to
set whether new dialogs should get a help button added.
* app/gui/gui.c
* libgimp/gimpui.c: call gimp_dialogs_show_help_button() according
to the gimprc settings.
2004-10-04 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-interface.c (script_fu_about): set
the help_func again (but not the help_id).
2004-10-04 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-interface.c (script_fu_about):
enabled line wrapping on labels.
(script_fu_interface): substitute underscores by hyphens to
generate the help-id from the procedure name.
2004-10-04 Michael Natterer <mitch@gimp.org>
* libgimpbase/gimpwire.c: added assertions to make sure "count" is
always >= 0. Turns the crash described in bug #154266 into a
warning plus corrupted wire state :) Real fix (in script-fu) will
follow. Untabified.
2004-10-04 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimphelpui.c: untabified.
(gimp_help_callback): use GIMP_HELP_ID instead of "gimp-help-id".
2004-10-04 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
set a minimum width for the color button again.
(script_fu_about): don't set help_func and help_id on the about
dialog.
2004-10-04 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/brush.pdb
* tools/pdbgen/pdb/gradient.pdb
* tools/pdbgen/pdb/palette.pdb: disallow the empty string for
new brushes, gradients and palettes and check the return value
of gimp_data_factory_data_new(). Cleanup.
* app/core/gimpbrushgenerated.c (gimp_brush_generated_new)
* app/core/gimpgradient.c (gimp_gradient_new)
* app/core/gimpdatafactory.c (gimp_data_factory_data_new): same
here. Fixes bug #154264.
* app/core/gimpdata.[ch] (gimp_data_set_filename): added boolean
"deletable" parameter because it's not derivable from "writable".
* app/core/gimpdatafactory.c (gimp_data_factory_load_data): need
to figure "deletable" separately from "writable" to be able to
delete unsavable stuff in the user-writable data directories.
Fixes bug #154410.
(gimp_data_factory_data_save_single): cleaned up.
* app/pdb/brush_cmds.c
* app/pdb/gradient_cmds.c
* app/pdb/palette_cmds.c
* libgimp/gimpbrush_pdb.c
* libgimp/gimpgradient_pdb.c
* libgimp/gimppalette_pdb.c: regenerated.
2004-10-04 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/asc2img.scm: a cleaned up version of
the script contributed by Kevin Cozens (see bug #153900).
* plug-ins/script-fu/scripts/predator.scm: applied patch by Kevin
Cozens that fixes use of the script on original layer (bug #152678).
2004-10-04 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/3d-outline.scm
* plug-ins/script-fu/scripts/blended-logo.scm
* plug-ins/script-fu/scripts/camo.scm
* plug-ins/script-fu/scripts/clothify.scm
* plug-ins/script-fu/scripts/flatland.scm
* plug-ins/script-fu/scripts/glossy.scm
* plug-ins/script-fu/scripts/land.scm
* plug-ins/script-fu/scripts/predator.scm
* plug-ins/script-fu/scripts/rendermap.scm
* plug-ins/script-fu/scripts/ripply-anim.scm
* plug-ins/script-fu/scripts/speed-text.scm
* plug-ins/script-fu/scripts/spinning-globe.scm: applied patches
from Kevin Cozens that define variables before first use (bug
#153900).
2004-10-04 Sven Neumann <sven@gimp.org>
* libgimp/gimpgradientmenu.c: handle allocation > requisition for
the gradient preview.
* plug-ins/script-fu/script-fu-interface.c: added a horizontal
size group for the left-aligned controls.
2004-10-03 DindinX <dindinx@gimp.org>
* plug-ins/common/destripe.c: ported to GimpDrawablePreview.
2004-10-03 DindinX <dindinx@gimp.org>
* plug-ins/common/nova.c: ported to GimpAspectPreview.
2004-10-03 DindinX <dindinx@gimp.org>
* plug-ins/common/max_rgb.c: ported to GimpAspectPreview.
2004-10-03 Michael Schumacher <schumaml@gmx.de>
* plug-ins/dbbrowser/Makefile.am
* plug-ins/script-fu/Makefile.am: moved the libgimpprocbrowser to
the beginning of LDADD
2004-10-03 DindinX <dindinx@gimp.org>
* libgimp/gimpaspectpreview.c: limit the size of the preview to 512
pixels. This prevents plug-ins using gimp_drawable_get_thumbnail_data
to crash.
2004-10-03 DindinX <dindinx@gimp.org>
* plug-ins/common/emboss.c: ported to GimpAspectPreview and made some
cleanups so this plug-in now use the same naming scheme as other
plug-ins do.
2004-10-03 DindinX <dindinx@gimp.org>
* plug-ins/common/whirlpinch.c: ported to GimpAspectPreview.
2004-10-03 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/color.pdb: export the Colorize tool to the PDB.
Fixes bug #154368.
* app/pdb/color_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpcolor_pdb.[ch]: regenerated.
2004-10-03 DindinX <dindinx@gimp.org>
* plug-ins/common/blinds.c: use a GimpAspectPreview to make the
preview resizable.
2004-10-03 DindinX <dindinx@gimp.org>
* plug-ins/common/ripple.c: Added a preview.
2004-10-02 DindinX <dindinx@gimp.org>
* plug-ins/common/polar.c: use a GimpAspectPreview.
2004-10-02 DindinX <dindinx@gimp.org>
* plug-ins/common/mapcolor.c: use a GimpAspectPreview and made the
code much simpler.
2004-10-02 DindinX <dindinx@gimp.org>
* plug-ins/common/illusion.c: use a GimpAspectPreview so the preview
is now resizable.
2004-10-02 DindinX <dindinx@gimp.org>
* plug-ins/common/apply_lens.c: added a preview. This plug-in still
need some work.
2004-10-01 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell-callbacks.c
(gimp_display_shell_tool_events): dispatch GDK_Escape to
GimpTool::key_press().
* app/tools/gimpcroptool.c (gimp_crop_tool_key_press)
* app/tools/gimpimagemaptool.c (gimp_image_map_tool_key_press):
* app/tools/gimptransformtool.c (gimp_transform_tool_key_press):
cancel the tool on <Escape>.
2004-10-01 Sven Neumann <sven@gimp.org>
* plug-ins/dbbrowser/plugin-browser.c: it's Plug-In, not Plugin.
2004-10-01 Sven Neumann <sven@gimp.org>
* app/tools/gimpcroptool.c (crop_response): destroy the info
dialog instead of hiding it. Fixes session management.
2004-10-01 Sven Neumann <sven@gimp.org>
* app/tools/gimpcroptool.c: unset the highlight from
crop_response() so it gets called when cropping is cancelled.
* app/dialogs/info-dialog.c (info_dialog_show): do what the
function name says, show the window, but don't present it.
Fixes bugs #128833 and #138816.
2004-10-01 Sven Neumann <sven@gimp.org>
* themes/Default/images/stock-frame-64.png: replaced the obtrusive
drop-shadow by a thin white frame with a subtle shadow. Taken from
a mockup done by Jimmac.
* app/widgets/gimpviewrenderer-frame.c: changed the hardcoded
offsets for the new frame image :(
2004-10-01 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-callbacks.c: no need to include
gimpdisplayshell-render.h here.
* app/display/gimpdisplayshell-draw.c
* app/display/gimpdisplayshell-render.[ch]
* app/display/gimpdisplayshell.[ch]: added an API to highlight a
rectangle (specified in image coordinates). Actually it doesn't
highlight but dims the area outside the rectangle.
* app/tools/gimpcroptool.c: use the new functionality to show the
area to be cropped. Fixes bug #93360.
2004-09-30 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/script-fu-types.h (struct SFScript): renamed
member "decription" to "menu_path".
* plug-ins/script-fu/script-fu-interface.c: changed accordingly.
* plug-ins/script-fu/script-fu-scripts.c: ditto. Don't pass the
menu_path as "blurb" to gimp_install_temp_proc(). Instead,
pass "help" as "blurb" and nothing as "help".
* plug-ins/script-fu/scripts/test-sphere.scm: shortened overly
long and useless help text.
2004-09-30 Michael Natterer <mitch@gimp.org>
* plug-ins/dbbrowser/gimpprocbox.c: don't include
"libgimp/stdplugins-intl.h".
* plug-ins/dbbrowser/gimpprocbrowser.c
* plug-ins/dbbrowser/plugin-browser.c: use gimp_destroy_paramdefs()
so we don't leak all param names and descriptions.
* plug-ins/dbbrowser/gimpprocview.c: don't show empty rows or
redundant information (help == blurb for deprecated procedures).
2004-09-30 Michael Natterer <mitch@gimp.org>
* plug-ins/dbbrowser/Makefile.am
* plug-ins/dbbrowser/gimpprocbox.c: new files holding more common
code from the two browsers.
* plug-ins/dbbrowser/gimpprocbrowser.c: use it.
* plug-ins/dbbrowser/plugin-browser.c: ditto. Re-enabled sorting
by all columns in both views. More cleanup.
2004-09-30 Sven Neumann <sven@gimp.org>
* README: added missing linebreak.
* plug-ins/imagemap/imap_about.c (do_about_dialog): should not
mark email address for translation.
2004-09-30 Daniel Egger <degger@fhm.edu>
* README: Applied proofreading patch from Jonathan Levi
<drjlevi@netonecom.net>.
2004-09-30 Michael Natterer <mitch@gimp.org>
Cleaned up the DB Browser and Plugin Details code and GUI. It's
not perfect yet but at least they don't look like crap any more.
Fixes bug #131490.
* plug-ins/common/plugin-defs.pl
* plug-ins/common/plugindetails.c: removed this plugin.
* plug-ins/common/.cvsignore
* plug-ins/common/Makefile.am: regenerated.
* plug-ins/dbbrowser/Makefile.am
* plug-ins/dbbrowser/dbbrowser.c
* plug-ins/dbbrowser/dbbrowser_utils.[ch]: removed these files.
* plug-ins/dbbrowser/gimpprocbrowser.[ch]
* plug-ins/dbbrowser/gimpprocview.[ch]: new cleaned up files.
* plug-ins/dbbrowser/plugin-browser.c: the former plugindetails.
* plug-ins/dbbrowser/procedure-browser.c: the former dbbrowser.
* plug-ins/script-fu/Makefile.am: link against the new library
libgimpprocbrowser.a
* plug-ins/script-fu/script-fu-console.c: changed #includes
accordingly. Minor cleanup.
* tools/pdbgen/pdb/plug_in.pdb (plugins_query): fixed menu_path
return value. Was broken since the plug-in menu registering
changes.
* app/pdb/plug_in_cmds.c: regenerated.
2004-09-30 Sven Neumann <sven@gimp.org>
* app/widgets/gimphelp.c (gimp_help_get_locales): fixed brokeness
I introduced with my last cleanup.
2004-09-29 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/plug-ins/gimpfu.py: applied slightly tweaked patch
from Joao S. O. Bueno, which adds a mutliline text field (PF_TEXT) and
untabbifies things. Closes bug #153921.
* plug-ins/pygimp/plug-ins/gimpplugin.py
* plug-ins/pygimp/plug-ins/gimpshelf.py
* plug-ins/pygimp/plug-ins/gimpui.py: Untabbify.
2004-09-29 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/plug-ins/gtkcons.py: minor tweak to history
behavior.
* plug-ins/pygimp/plug-ins/clothify.py
* plug-ins/pygimp/plug-ins/foggify.py
* plug-ins/pygimp/plug-ins/gimpcons.py
* plug-ins/pygimp/plug-ins/gtkcons.py
* plug-ins/pygimp/plug-ins/pdbbrowse.py
* plug-ins/pygimp/plug-ins/shadow_bevel.py
* plug-ins/pygimp/plug-ins/sphere.py
* plug-ins/pygimp/plug-ins/whirlpinch.py: Untabbify.
2004-09-29 Sven Neumann <sven@gimp.org>
* app/tools/gimpcropoptions.c (gimp_crop_options_gui): plugged a
tiny memleak spotted by Olivier.
2004-09-29 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.[ch]
* libgimpwidgets/gimpwidgets.def: added gimp_preview_draw_buffer().
* libgimp/gimpaspectpreview.[ch]
* libgimp/gimpdrawablepreview.[ch]
* libgimp/gimpui.def: removed the public draw_buffer API.
Implement the virtual GimpPreview::draw_buffer method instead.
* plug-ins/common/cartoon.c
* plug-ins/common/deinterlace.c
* plug-ins/common/despeckle.c
* plug-ins/common/dog.c
* plug-ins/common/edge.c
* plug-ins/common/engrave.c
* plug-ins/common/exchange.c
* plug-ins/common/gauss.c
* plug-ins/common/grid.c
* plug-ins/common/neon.c
* plug-ins/common/noisify.c
* plug-ins/common/oilify.c
* plug-ins/common/photocopy.c
* plug-ins/common/plasma.c
* plug-ins/common/sel_gauss.c
* plug-ins/common/sharpen.c
* plug-ins/common/shift.c
* plug-ins/common/snoise.c
* plug-ins/common/sobel.c
* plug-ins/common/spread.c
* plug-ins/common/struc.c: changed accordingly. Don't pass the
preview around as GimpDrawablePreview or GimpAspectPreview. It
should whenever possible be accessed as GimpPreview.
2004-09-29 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.[ch]
* libgimpwidgets/gimpscrolledpreview.[ch]
* libgimpwidgets/gimpwidgets.def: moved the offsets and the
draw_thumb method back to the GimpPreview class.
* libgimp/gimpdrawablepreview.c: changed accordingly.
* plug-ins/common/bumpmap.c
* plug-ins/common/cartoon.c
* plug-ins/common/deinterlace.c
* plug-ins/common/despeckle.c
* plug-ins/common/dog.c
* plug-ins/common/edge.c
* plug-ins/common/engrave.c
* plug-ins/common/exchange.c
* plug-ins/common/gauss.c
* plug-ins/common/grid.c
* plug-ins/common/mblur.c
* plug-ins/common/neon.c
* plug-ins/common/noisify.c
* plug-ins/common/oilify.c
* plug-ins/common/photocopy.c
* plug-ins/common/sel_gauss.c
* plug-ins/common/sharpen.c
* plug-ins/common/shift.c
* plug-ins/common/sobel.c
* plug-ins/common/softglow.c
* plug-ins/common/spread.c
* plug-ins/common/struc.c
* plug-ins/common/unsharp.c
* plug-ins/common/wind.c: back to using gimp_preview_get_position().
* libgimp/gimpregioniterator.c (gimp_rgn_iterator_new): corrected
gtk-doc comment.
2004-09-29 DindinX <dindinx@gimp.org>
* plug-ins/common/snoise.c: Use a GimpAspectPreview here, so the
preview is resizable.
2004-09-29 Sven Neumann <sven@gimp.org>
* libgimp/gimpui.def
* libgimpwidgets/gimpwidgets.def: updated.
2004-09-29 DindinX <dindinx@gimp.org>
* libgimpwidgets/gimppreview.c
* libgimpwidgets/gimppreview.h: split this widget into itself (more
abstract now) and ...
* libgimpwidgets/gimpscrolledpreview.c
* libgimpwidgets/gimpscrolledpreview.h: this widget which also have
some scrollbars and a nagivation preview.
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpwidgetstypes.h: changed accordingly.
* libgimp/gimpaspectpreview.c
* libgimp/gimpaspectpreview.h: Added this widget, derived from
GimpPreview, which has always the same ratio has the given drawable.
This widget has almost the same api as GimpDrawablePreview, and is
useful for plug-ins that show the whole (scaled) drawable in their
preview.
* libgimp/gimpdrawablepreview.c
* libgimp/gimpdrawablepreview.h: GimpDrawablePreview is now derived
from GimpScrolledPreview.
* libgimp/Makefile.am
* libgimp/gimpui.h
* libgimp/gimpuitypes.h: changed accordingly.
* plug-ins/common/plasma.c: use a GimpAspectPreview.
* plug-ins/common/bumpmap.c
* plug-ins/common/cartoon.c
* plug-ins/common/deinterlace.c
* plug-ins/common/despeckle.c
* plug-ins/common/dog.c
* plug-ins/common/edge.c
* plug-ins/common/engrave.c
* plug-ins/common/exchange.c
* plug-ins/common/gauss.c
* plug-ins/common/grid.c
* plug-ins/common/mblur.c
* plug-ins/common/neon.c
* plug-ins/common/noisify.c
* plug-ins/common/oilify.c
* plug-ins/common/photocopy.c
* plug-ins/common/sel_gauss.c
* plug-ins/common/sharpen.c
* plug-ins/common/shift.c
* plug-ins/common/sobel.c
* plug-ins/common/softglow.c
* plug-ins/common/spread.c
* plug-ins/common/struc.c
* plug-ins/common/unsharp.c
* plug-ins/common/wind.c: use gimp_scrolled_preview_get_position
instead of gimp_preview_get_position.
2004-09-29 Michael Natterer <mitch@gimp.org>
* libgimp/gimpregioniterator.[ch]: renamed the "run_mode"
parameters to "unused" and remode the rum_mode member from the
private GimpRgbIterator struct.
* plug-ins/common/AlienMap2.c
* plug-ins/common/autostretch_hsv.c
* plug-ins/common/c_astretch.c
* plug-ins/common/color_enhance.c
* plug-ins/common/colorify.c
* plug-ins/common/colortoalpha.c
* plug-ins/common/gradmap.c
* plug-ins/common/mapcolor.c
* plug-ins/common/max_rgb.c
* plug-ins/common/noisify.c
* plug-ins/common/normalize.c
* plug-ins/common/sample_colorize.c
* plug-ins/common/scatter_hsv.c
* plug-ins/common/semiflatten.c
* plug-ins/common/threshold_alpha.c
* plug-ins/common/vinvert.c
* plug-ins/fp/fp.c: made "run_mode" a private variable of run()
and pass 0 to gimp_rgn_iterate*(). Minor cleanups.
2004-09-29 Sven Neumann <sven@gimp.org>
* libgimp/gimp.def
* libgimp/gimpui.def
* libgimpwidgets/gimpwidgets.def: updated.
2004-09-29 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/Makefile.am
* tools/pdbgen/groups.pl: renamed group "gradient_edit" to
"gradient" and added "brush", "palette" and "pattern" groups.
* tools/pdbgen/pdb/gradient_edit.pdb: removed.
* tools/pdbgen/pdb/brush.pdb
* tools/pdbgen/pdb/gradient.pdb
* tools/pdbgen/pdb/palette.pdb
* tools/pdbgen/pdb/pattern.pdb: new files containing functions
which create, duplicate, rename, delete, query and manipulate
a single brush, pattern etc.
* tools/pdbgen/pdb/brushes.pdb
* tools/pdbgen/pdb/gradients.pdb
* tools/pdbgen/pdb/palettes.pdb
* tools/pdbgen/pdb/patterns.pdb: deprecated stuff that is obsolete
now and simply removed the procedures that were added after 2.0.
* app/pdb/gradient_edit_cmds.c
* libgimp/gimpgradientedit_pdb.[ch]: removed.
* app/pdb/brush_cmds.c
* app/pdb/gradient_cmds.c
* app/pdb/palette_cmds.c
* app/pdb/pattern_cmds.c
* libgimp/gimpbrush_pdb.[ch]
* libgimp/gimpgradient_pdb.[ch]
* libgimp/gimppalette_pdb.[ch]
* libgimp/gimppattern_pdb.[ch]: new files.
* app/pdb/brushes_cmds.c
* app/pdb/gradients_cmds.c
* app/pdb/internal_procs.c
* app/pdb/palettes_cmds.c
* app/pdb/patterns_cmds.c
* libgimp/gimp_pdb.h
* libgimp/gimpbrushes_pdb.[ch]
* libgimp/gimpgradients_pdb.[ch]
* libgimp/gimppalettes_pdb.[ch]
* libgimp/gimppatterns_pdb.[ch]: regenerated.
* app/pdb/Makefile.am
* libgimp/Makefile.am
* plug-ins/gfig/gfig-style.c: changed accordingly.
2004-09-28 Sven Neumann <sven@gimp.org>
* app/file/gimprecentlist.c (gimp_recent_list_write): don't write
empty groups.
* app/file/gimprecentlist.c: disabled the code for the win32
platform. It doesn't make much sense there anyway. If someone
wants to contribute a win32 specific implementation, we'd welcome
that. A Mac OS X implementation would be nice to have as well.
2004-09-28 Sven Neumann <sven@gimp.org>
* etc/ps-menurc: updated for GIMP 2.1 by Eric Pierce.
2004-09-28 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/imagemap/imap_circle.c:
* plug-ins/imagemap/imap_cmd_gimp_guides.c
* plug-ins/imagemap/imap_edit_area_info.c
* plug-ins/imagemap/imap_grid.c
* plug-ins/imagemap/imap_polygon.c
* plug-ins/imagemap/imap_rectangle.c
* plug-ins/imagemap/imap_settings.c: first set of changes to make
imagemap fully HIG compliant. More to come.
2004-09-28 Sven Neumann <sven@gimp.org>
* app/file/gimprecentlist.c: seek to the start of the file before
calling lockf().
2004-09-28 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/common/borderaverage.c: added size entry. Fixes #143156
(Use size entry widget in Borderaverage plug-in)
2004-09-28 Sven Neumann <sven@gimp.org>
* docs/gimp.1.in: updated name of the splash image.
2004-09-28 Michael Natterer <mitch@gimp.org>
* app/core/gimppalette.c: code review / cleanup.
(gimp_palette_delete_entry): don't add "Black" when the last color
gets removed, a palette can easily live with zero colors.
* app/widgets/gimppaletteeditor.c
(palette_editor_invalidate_preview): also update the entry which
shows the palette_entry's name.
2004-09-28 Sven Neumann <sven@gimp.org>
* app/file/gimprecentlist.c (gimp_recent_list_write_raw): handle
EINTR while writing.
2004-09-28 Sven Neumann <sven@gimp.org>
* app/config/gimpxmlparser.[ch]: added new convenience function
gimp_xml_parser_parse_fd().
* app/file/Makefile.am
* app/file/gimprecentitem.[ch]
* app/file/gimprecentlist.[ch]: added an implementation of the
recent-files spec as found on freedesktop.org. This code is taken
from libegg and has been edited to fit the GIMP needs.
* app/file/file-open.c
* app/file/file-save.c: update the ~/.recently-used file. Fixes
bug #131206.
2004-09-28 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainerbox.c (gimp_container_box_get_preview):
removed hack which strcmp()s the property name to figure the
preview's border_width and use the container view's
preview_border_width instead.
2004-09-28 Sven Neumann <sven@gimp.org>
* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
simplified code and removed a compiler warning.
2004-09-28 Carol Spears <carol@gimp.org>
* data/images/gimp-splash.png there was a white spot that was making
me crazy. It is gone now.
2004-09-28 Sven Neumann <sven@gimp.org>
* app/widgets/gimpaction.c (gimp_action_set_proxy): added a hack
to get rid of the border drawn around thumbnails in the "Open Recent"
menu.
2004-09-28 Sven Neumann <sven@gimp.org>
* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
add a shortcut to the filechooser that points to the user's folder.
* app/actions/vectors-commands.c: added a file filter to the SVG
import dialog.
2004-09-27 Sven Neumann <sven@gimp.org>
* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): added some
padding for the shadow frame to avoid scaling the thumbnail.
2004-09-27 Sven Neumann <sven@gimp.org>
* themes/Default/images/Makefile.am
* themes/Default/images/stock-frame-64.png: added a stock icon
that shows a simple drop shadow but could be exchanged for other
image decorations.
* libgimpwidgets/gimpstock.[ch]: register the new icon.
* app/widgets/Makefile.am
* app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some
ugly code to draw a frame around a preview pixbuf.
* app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached
to the GimpViewRenderer class so it can be shared by all renderers.
* app/widgets/gimpviewrendererimagefile.c: use the new functionality
to draw a nice frame around imagefile previews.
* app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border.
2004-09-27 Michael Natterer <mitch@gimp.org>
* app/actions/data-commands.c: cleanup.
* app/actions/vectors-commands.c
* app/display/gimpdisplayshell.c
* tools/pdbgen/pdb/paint_tools.pdb: removed unused #includes.
* app/text/gimptext-bitmap.c
* app/text/gimptext-parasite.c
* app/text/gimptext-vectors.c
* app/text/gimptext-xlfd.c
* app/text/gimptext.c
* app/text/gimptextlayer-xcf.c: include "text-types.h" instead
of "text/text-types.h".
* app/widgets/gimppatternselect.c: create a GimpPatternFactoryView
instead of GimpDataFactoryView.
* app/pdb/paint_tools_cmds.c: regenerated.
2004-09-27 Michael Natterer <mitch@gimp.org>
* app/actions/brushes-actions.c
* app/actions/gradients-actions.c
* app/actions/palettes-actions.c
* app/actions/patterns-actions.c: made the "foo-edit" actions
GimpStringActions and pass the identifier of the editor dialog
to the callback.
* app/actions/data-commands.[ch] (data_edit_data_cmd_callback):
show the editor dialog here instead of calling view->edit_func().
* app/dialogs/dialogs-constructors.[ch]: removed the brush,
gradient and palette edit_funcs.
* app/widgets/widgets-types.h: removed typedef GimpDataEditFunc.
* app/widgets/gimpdatafactoryview.[ch]: removed the edit_func
member and parameters and create the edit button unconditionally.
* app/widgets/gimpbrushfactoryview.[ch]
* app/widgets/gimppatternfactoryview.[ch]: changed accordingly.
* app/widgets/Makefile.am
* app/widgets/gimpdataselect.[ch]: removed this class, it's not
needed any longer.
* app/widgets/gimpbrushselect.[ch]
* app/widgets/gimpgradientselect.[ch]
* app/widgets/gimppaletteselect.[ch]
* app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog
and follow the edit_func removal.
* app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func
stuff.
* app/widgets/gimpcontainereditor.c: minor unrelated cleanup.
2004-09-27 Michael Natterer <mitch@gimp.org>
* app/dialogs/dialogs-constrcutors.[ch]: renamed some constructors
for consistency and added a (useless) template grid.
* app/dialogs/dialogs.c: make the arrays of GimpDialogFactoryEntries
more readable by using macros to define them.
2004-09-27 Sven Neumann <sven@gimp.org>
* app/core/gimpimagefile.c: removed conversion to TempBuf.
Instead implement GimpViewable::get_new_pixbuf by compositing the
thumbnail on a checkerboard.
* app/widgets/gimpviewrenderer.[ch]: renamed the no_view_pixbuf
struct member to pixbuf.
(gimp_view_renderer_real_render): try gimp_viewable_get_pixbuf()
and render the pixbuf before falling back to the TempBuf preview.
(gimp_view_renderer_render_pixbuf): new function that sets a
pixbuf for the renderer and flushes the render_buffer.
* app/widgets/gimpviewrendererimagefile.c
(gimp_view_renderer_imagefile_render): render the pixbuf.
* app/dialogs/dialogs-constructors.c: create the document history
dockable with a zero borderwidth.
2004-09-27 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail_invoker): use
the GIMP_CHECK_SIZE_SM define, not the enum value
GIMP_CHECK_SIZE_SMALL_CHECKS which is 0 (eeek!).
* app/pdb/fileops_cmds.c: regenerated.
* app/widgets/gimphelp.c (gimp_help_get_locales): minor cleanup.
2004-09-26 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdataeditor.[ch]: added "data" property.
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimppaletteeditor.c: pass the current data to
g_object_new() so we never end up with initially empty editors.
2004-09-26 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdataeditor.[ch]: added CONSTRUCT_ONLY
"data-factory" property. Removed gimp_data_editor_construct().
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimppaletteeditor.c: pass the construct parameters
to g_object_new().
2004-09-26 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcolorframe.c: changed label alignment to be more
HIG conformant and consistent with the rest of the user interface.
2004-09-26 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdialogfactory.[ch]: added "name", "blurb",
"stock_id" and "help_id" to struct GimpDialogFactoryEntry and to
gimp_dialog_factory_dialog_register(). Added typedef
GimpDialogConstructor which takes a GimpDialogFactoryEntry in
addition to the parameters GimpDialogNewFunc takes. Added a
constructor function pointer to GimpDialogFactory which defaults
to a function that just returns entry->new_func(). Use that
constructor instead of entry->new_func() for creating
dialogs. Added public API gimp_dialog_factory_set_constructor().
* app/dialogs/dialogs.c: register name, blurb, stock_id and
help_id for all dockables so all the dialog info lives in one huge
ugly table now. For the global_toolbox_factory and the
global_dock_factory, set a constructor which creates a dockable
around the widget returned by entry->new_func().
* app/dialogs/dialogs-constructors.[ch]: don't create the dockable
in each dialog constructor. Removes tons of code and reduces most
constructors to a "return gimp_foo_new(...)" one-liner. Got rid of
all static variables, they were from a time when GimpDialogFactory
was unable to manage singletons.
* app/widgets/gimpbrusheditor.[ch]
* app/widgets/gimpgradienteditor.[ch]
* app/widgets/gimppaletteeditor.[ch]: return GtkWidget, not
GimpDataEditor from gimp_foo_editor_new().
* app/widgets/gimpdataeditor.c: minor cleanups.
2004-09-26 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcolordialog.c: moved stuff from new() to init().
2004-09-26 Michael Natterer <mitch@gimp.org>
Ported GimpNavigationView to use actions for its buttons:
* app/menus/menus.c (menus_init): register a <GimpNavigationEditor>
UI manager containing the "view" action group.
* app/actions/actions.c (action_data_get_foo): handle "data" being
a GimpNavigationEditor.
* app/actions/view-actions.c (view_actions): added tooltips for
the actions used in the editor.
(view_actions_update): use action_data_get_display() instead of
checking the type of "data" manually.
* app/widgets/gimpeditor.c (gimp_editor_add_action_button): use
a GtkToggleButton instead of GimpButton for GtkToggleActions.
* app/display/gimpnavigationeditor.[ch]: added a GimpMenuFactory
parameter to the public constructor and removed all other
parameters. Simplified gimp_navigation_editor_new_private() and
use gimp_editor_add_action_button() instead of just add_button()
for creating the buttons. Made gimp_navigation_view_set_shell()
private. Update the UI manager when the shell zooms or scrolls.
* app/dialogs/dialogs-constructors.c (dialogs_navigation_view_new):
pass the menu_factory to gimp_navigation_editor_new().
Removed #includes which are not needed any more.
2004-09-26 DindinX <dindinx@gimp.org>
* plug-ins/common/exchange.c: use the same preview as in all other
plug-ins.
2004-09-25 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_stock.c: removed C++ style comment.
2004-09-25 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/imagemap/imap_stock.[ch]
* plug-ins/imagemap/Makefile.am
* plug-ins/imagemap/*.xpm: get rid of all .xpm images
* configure.in
* plug-ins/imagemap/images/*: and add them as .png here
* plug-ins/imagemap/imap_browse.c: remove unused include.
2004-09-25 Sven Neumann <sven@gimp.org>
* app/widgets/gimpviewrenderer.h: removed trailing whitespace.
2004-09-25 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-close.c: changed mnemonic so that
you can close an image w/o saving it by using Ctrl-W Alt-W.
2004-09-25 Michael Natterer <mitch@gimp.org>
* app/core/gimpimage-qmask.h: added comment about not changing the
silly "Qmask" string because it is used to identify the Quick Mask
in the XCF.
* app/core/gimpchannel.c: implement GimpViewable::get_description()
and return "Quick Mask" if it's the Quick Mask.
* app/actions/qmask-actions.c
* app/actions/qmask-commands.c
* app/core/core-enums.[ch]
* app/core/gimpimage-qmask.c
* app/display/gimpdisplayshell.c: s/QuickMask/Quick Mask/.
2004-09-25 DindinX <dindinx@gimp.org>
* plug-ins/common/engrave.c: Added a preview and #if'ed out some
unreachable code.
2004-09-25 Michael Natterer <mitch@gimp.org>
* app/core/gimppickable.[ch]: added new vitrual function
GimpPickableInterface::get_image()
* app/core/gimpdrawable.c
* app/core/gimpimagemap.c
* app/core/gimpprojection.[ch]: implement it.
2004-09-25 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcolormapeditor.[ch]
* app/widgets/gimphistogrameditor.[ch]
* app/widgets/gimpselectioneditor.[ch]: removed redundant "gimage"
parameters from public constructors. They are all GimpImageEditor
widgets which get their image via gimp_docked_set_context() and
gimp_image_editor_set_image() later anyway. Fixes uglyness as well
as problems where the editors had an image but no context, causing
strange behavior in their foo_actions_update() functions.
* app/dialogs/dialogs-constructors.c: changed accordingly. Removed
redundant calls to gimp_dockable_set_context() on newly created
dockables because they will get a context when added to their
containers.
2004-09-25 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcolormapeditor.c: moved stuff from
gimp_colormap_editor_new() to
gimp_colormap_editor_init(). Untabified.
2004-09-25 DindinX <dindinx@gimp.org>
* plug-ins/common/dog.c: made the preview behave like in all other
plug-ins by using a GimpDrawablePreview. This allowed to remove a
bunch of complicated code.
2004-09-25 Sven Neumann <sven@gimp.org>
* app/widgets/gimptemplateeditor.[ch]: added resolution and image
type information which is usually hidden in the Advanced Options.
2004-09-25 DindinX <dindinx@gimp.org>
* plug-ins/common/oilify.c: Added a preview and made some small
cleanups.
2004-09-24 Sven Neumann <sven@gimp.org>
* app/config/gimprc-blurbs.h (LAYER_PREVIEW_SIZE_BLURB): try to
improve the tooltip for the layer-preview-size gimprc setting.
Addresses bug #153603.
2004-09-24 Michael Natterer <mitch@gimp.org>
* app/core/gimpimage-undo-push.c (undo_pop_fs_to_layer): factored
common code out of the UNDO amd REDO cases. Use gimp_drawable_update()
instead of gimp_viewable_invalidate_preview() so the projection
gets updated correctly. Fixes bug #149558.
* app/core/gimplayer-floating-sel.c (floating_sel_to_layer):
removed unused variables and their assignments.
2004-09-24 Sven Neumann <sven@gimp.org>
* app/widgets/gimptemplateeditor.[ch]: added a label that shows
the pixel size (as in the initial mockup done by Jimmac).
2004-09-24 Michael Natterer <mitch@gimp.org>
* app/tools/gimpimagemaptool.c
(gimp_image_map_tool_settings_dialog): set the folder using
gtk_file_chooser_set_current_folder(), not set_filename().
2004-09-24 Sven Neumann <sven@gimp.org>
* app/base/curves.[ch]
* app/tools/gimpcurvestool.c: defined CURVES_NUM_POINTS and use it.
* tools/pdbgen/pdb/color.pdb (curves_spline_invoker): unset the
last control point which got initialized to (255,255) by
curves_init(). Fixes bug #153635.
* app/pdb/color_cmds.c: regenerated.
2004-09-24 Sven Neumann <sven@gimp.org>
* app/plug-in/plug-in-message.c: removed a linebreak from a
warning message.
2004-09-24 Michael Natterer <mitch@gimp.org>
* app/paint/gimpairbrushoptions.c
* app/paint/gimpcloneoptions.c
* app/paint/gimpconvolveoptions.c
* app/paint/gimpdodgeburnoptions.c
* app/paint/gimperaseroptions.c
* app/paint/gimpinkoptions.c
* app/paint/gimppaintoptions.c
* app/paint/gimppenciloptions.c
* app/paint/gimpsmudgeoptions.c
* app/tools/gimpblendoptions.c
* app/tools/gimpbucketfilloptions.c
* app/tools/gimpcoloroptions.c
* app/tools/gimpcolorpickeroptions.c
* app/tools/gimpcropoptions.c
* app/tools/gimpflipoptions.c
* app/tools/gimphistogramoptions.c
* app/tools/gimpimagemapoptions.c
* app/tools/gimpmagnifyoptions.c
* app/tools/gimpmeasureoptions.c
* app/tools/gimpmoveoptions.c
* app/tools/gimppaintoptions-gui.c
* app/tools/gimpselectionoptions.c
* app/tools/gimptextoptions.c
* app/tools/gimptransformoptions.c
* app/tools/gimpvectoroptions.c: code cleanup: untabified and
trailing whitespace removal, removed empty instance_init()
funcions, cleaned up variable declarations/initializations.
2004-09-23 Michael Natterer <mitch@gimp.org>
* app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register)
* app/tools/gimppenciltool.c (gimp_pencil_tool_register):
add GIMP_CONTEXT_GRADIENT_MASK to the tools' context_props because
these tools use the current gradient. Fixes bug #153584.
2004-09-23 Michael Natterer <mitch@gimp.org>
* app/dialogs/Makefile.am
* app/dialogs/color-dialog.[ch]: removed...
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpcolordialog.[ch]: ...and added as widget.
* app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM.
* app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState.
* app/widgets/gimpcolormapeditor.[ch]
* app/widgets/gimpcolorpanel.[ch]
* app/widgets/gimpgradienteditor.[ch]
* app/widgets/gimppaletteeditor.[ch]
* app/widgets/gimptoolbox-color-area.c
* app/actions/gradient-editor-commands.c
* app/actions/view-commands.c: ported to GimpColorDialog. Removes
a whole bunch of ugly widgets/ -> dialogs/ dependencies.
2004-09-23 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-interface.c: put the text view into
a scrolled window. Removed "changed" callbacks for GtkEntry and
GtkTextView. Instead retrieve the final string when the dialog is
confirmed.
* plug-ins/script-fu/scripts/carved-logo.scm
* plug-ins/script-fu/scripts/chrome-it.scm
* plug-ins/script-fu/scripts/crystal-logo.scm
* plug-ins/script-fu/scripts/sota-chrome-logo.scm: use
gimp-data-directory instead of the deprecated constant
gimp-data-dir.
* plug-ins/script-fu/scripts/mkbrush.scm: unmarked strings for
translation that I marked yesterday. Won't work unfortunately.
2004-09-23 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/blended-logo.scm: fixed context
push/pop.
2004-09-23 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-enums.h
* plug-ins/script-fu/script-fu-interface.c
* plug-ins/script-fu/script-fu-scripts.c
* plug-ins/script-fu/siod-wrapper.c: applied a patch by Kevin
Cozens, based on a patch by Dov Grobgeld. Implements multi-line
text input in Script-Fu (bug #124394).
* plug-ins/script-fu/scripts/test-sphere.scm: test the new SF-TEXT
parameter.
2004-09-23 Sven Neumann <sven@gimp.org>
* libgimp/gimppixbuf.c (gimp_drawable_get_thumbnail,
gimp_image_get_thumbnail): use the exported symbols from
libgimp, not the private _gimp_drawable_thumbnail()
and _gimp_image_thumbnail() functions.
* libgimp/gimp.def: added new symbols, removed
_gimp_image_thumbnail and _gimp_drawable_thumbnail.
2004-09-23 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/brushes.pdb
* tools/pdbgen/pdb/gradients.pdb
* tools/pdbgen/pdb/palettes.pdb
* tools/pdbgen/pdb/patterns.pdb: removed the foos_set_foo()
procedures and marked the foos_get_foo() ones as deprecated. For
brushes, patterns and palettes, added foos_get_foo_info()
procedures which work like foos_get_foo_data() but return just the
properties, not the actual data. Allow NULL or "" to be passed
as name to all functions (use the current brush, pattern etc.
in this case).
* tools/pdbgen/pdb/fonts.pdb: cleanup.
* app/pdb/procedural_db.c: added the removed ones to the compat
hash table.
* libgimp/Makefile.am
* libgimp/gimpbrushes.[ch]
* libgimp/gimpgradients.[ch]
* libgimp/gimppalettes.[ch]
* libgimp/gimppatterns.[ch]: new files with compat functions
wich call the resp. gimp_context_*() functions.
* libgimp/gimp.h: changed accordingly.
* app/pdb/brushes_cmds.c
* app/pdb/gradients_cmds.c
* app/pdb/internal_procs.c
* app/pdb/palettes_cmds.c
* app/pdb/patterns_cmds.c
* libgimp/gimpbrushes_pdb.[ch]
* libgimp/gimpgradients_pdb.[ch]
* libgimp/gimppalettes_pdb.[ch]
* libgimp/gimppatterns_pdb.[ch]: regenerated.
* plug-ins/FractalExplorer/Dialogs.c
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-style.[ch]
* plug-ins/gflare/gflare.c: changed accordingly.
2004-09-23 Michael Natterer <mitch@gimp.org>
* plug-ins/common/bumpmap.c (bumpmap_dialog): added a GtkPaned for
packing preview and controls so the controls are resizable again.
2004-09-23 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/scripts/3d-outline.scm
* plug-ins/script-fu/scripts/beveled-pattern-arrow.scm
* plug-ins/script-fu/scripts/beveled-pattern-bullet.scm
* plug-ins/script-fu/scripts/beveled-pattern-button.scm
* plug-ins/script-fu/scripts/beveled-pattern-heading.scm
* plug-ins/script-fu/scripts/beveled-pattern-hrule.scm
* plug-ins/script-fu/scripts/blended-logo.scm
* plug-ins/script-fu/scripts/carve-it.scm
* plug-ins/script-fu/scripts/carved-logo.scm
* plug-ins/script-fu/scripts/chip-away.scm
* plug-ins/script-fu/scripts/chrome-it.scm
* plug-ins/script-fu/scripts/coffee.scm
* plug-ins/script-fu/scripts/comic-logo.scm
* plug-ins/script-fu/scripts/coolmetal-logo.scm
* plug-ins/script-fu/scripts/crystal-logo.scm
* plug-ins/script-fu/scripts/frosty-logo.scm
* plug-ins/script-fu/scripts/glossy.scm
* plug-ins/script-fu/scripts/hsv-graph.scm
* plug-ins/script-fu/scripts/land.scm
* plug-ins/script-fu/scripts/lava.scm
* plug-ins/script-fu/scripts/mkbrush.scm
* plug-ins/script-fu/scripts/rendermap.scm
* plug-ins/script-fu/scripts/select-to-brush.scm
* plug-ins/script-fu/scripts/select-to-pattern.scm
* plug-ins/script-fu/scripts/sota-chrome-logo.scm
* plug-ins/script-fu/scripts/spyrogimp.scm
* plug-ins/script-fu/scripts/starburst-logo.scm
* plug-ins/script-fu/scripts/starscape-logo.scm
* plug-ins/script-fu/scripts/t-o-p-logo.scm
* plug-ins/script-fu/scripts/test-sphere.scm
* plug-ins/script-fu/scripts/textured-logo.scm: use the new
opacity, paint_mode, brush, pattern, gradient, palette and font
accessors.
2004-09-23 Sven Neumann <sven@gimp.org>
Converted the last bunch of scripts to the new context API:
* plug-ins/script-fu/scripts/[s-z]*.scm
2004-09-23 Sven Neumann <sven@gimp.org>
Converted more scripts to the new context API:
* plug-ins/script-fu/scripts/glossy.scm
* plug-ins/script-fu/scripts/hsv-graph.scm
* plug-ins/script-fu/scripts/image-structure.scm
* plug-ins/script-fu/scripts/perspective-shadow.scm
* plug-ins/script-fu/scripts/pupi-button.scm
* plug-ins/script-fu/scripts/rendermap.scm
* plug-ins/script-fu/scripts/ripply-anim.scm
2004-09-23 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/hsv-graph.scm:
* tools/pdbgen/pdb/context.pdb: oops, should probably pop, not
push a context in gimp_context_pop().
* app/pdb/context_cmds.c: regenerated.
* plug-ins/script-fu/scripts/mkbrush.scm: don't fiddle with the
brush description, simply use the name choosen by the user.
2004-09-23 Sven Neumann <sven@gimp.org>
Converted the next bunch of scripts to the new context API:
* plug-ins/script-fu/scripts/[d-n]*.scm: push and pop a context.
Removed code that used to restore the context values changed by
the scripts.
2004-09-23 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in-message.c (plug_in_handle_proc_return_priv):
removed warning about entering a dead code path. That path is not
dead at all :)
2004-09-23 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/context.pdb: added accessors for the context's
brush, pattern, gradient, palette and brush. Deprecation of old
functions will follow. Fixes gimp-context-set-background wrapper.
Cleanup.
* tools/pdbgen/pdb/patterns.pdb
* libgimp/gimpbrushes.h: minor fixes.
* app/pdb/context_cmds.c
* app/pdb/internal_procs.c
* app/pdb/patterns_cmds.c
* libgimp/gimpcontext_pdb.[ch]: regenerated.
2004-09-23 Sven Neumann <sven@gimp.org>
* plug-ins/common/bumpmap.c (bumpmap_dialog): cosmetics.
2004-09-22 Kevin Turner <acapnotic@twistedmatrix.com>
* plug-ins/pygimp/gimpfu.py (register): clean up errors in
parameter checking.
2004-09-22 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/brushes.pdb: removed the opacity and paint_mode
functions...
* tools/pdbgen/pdb/context.pdb: ...and added them here.
* app/pdb/procedural_db.c: added them to the pdb_compat hash table.
* libgimp/Makefile.am
* libgimp/gimpbrushes.[ch]: new files with compat functions
which call the gimp_context_*() functions.
* libgimp/gimp.h: changed accordingly.
* app/pdb/brushes_cmds.c
* app/pdb/context_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpbrushes_pdb.[ch]
* libgimp/gimpcontext_pdb.[ch]: regenerated.
2004-09-22 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/Makefile.am
* tools/pdbgen/groups.pl
* tools/pdbgen/pdb/palette.pdb: removed the "Palette" pdb group...
* tools/pdbgen/pdb/context.pdb: and added its functions to the
"Context" namespace instead.
* app/pdb/Makefile.am
* app/pdb/palette_cmds.c: removed.
* app/pdb/procedural_db.c: added them to the pdb_compat hash table.
* libgimp/Makefile.am
* libgimp/gimppalette_pdb.[ch]: removed.
* libgimp/gimppalette.[ch]: new files holding compat functions
which call gimp_context_*() functions.
* libgimp/gimp.h
* libgimp/gimpui.c: changed accordingly.
* app/pdb/context_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimp_pdb.h
* libgimp/gimpcontext_pdb.[ch]: regenerated.
* plug-ins/MapObject/mapobject_image.c
* plug-ins/MapObject/mapobject_preview.c
* plug-ins/common/apply_lens.c
* plug-ins/common/blinds.c
* plug-ins/common/borderaverage.c
* plug-ins/common/checkerboard.c
* plug-ins/common/colortoalpha.c
* plug-ins/common/cubism.c
* plug-ins/common/exchange.c
* plug-ins/common/film.c
* plug-ins/common/gif.c
* plug-ins/common/grid.c
* plug-ins/common/mapcolor.c
* plug-ins/common/mblur.c
* plug-ins/common/mng.c
* plug-ins/common/mosaic.c
* plug-ins/common/papertile.c
* plug-ins/common/png.c
* plug-ins/common/polar.c
* plug-ins/common/semiflatten.c
* plug-ins/common/sinus.c
* plug-ins/common/sparkle.c
* plug-ins/common/vpropagate.c
* plug-ins/common/warp.c
* plug-ins/common/whirlpinch.c
* plug-ins/gfig/gfig-style.c
* plug-ins/gfli/gfli.c
* plug-ins/ifscompose/ifscompose.c
* plug-ins/maze/handy.c
* plug-ins/pagecurl/pagecurl.c
* plug-ins/pygimp/gimpmodule.c
* plug-ins/script-fu/scripts/*.scm: changed accordingly.
2004-09-22 Sven Neumann <sven@gimp.org>
* app/actions/view-actions.c (view_zoom_actions): mark menu label
as translatable (bug #153456).
2004-09-22 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/siod-wrapper.c
* plug-ins/script-fu/scripts/mkbrush.scm
* plug-ins/script-fu/scripts/select-to-brush.scm
* plug-ins/script-fu/scripts/select-to-pattern.scm: applied a
patch from Kevin Cozens that adds constants for the directory
names exposed by libgimpbase. Fixes bug #153327.
2004-09-22 Sven Neumann <sven@gimp.org>
Converted the first bunch of Script-Fu to the new context API:
* plug-ins/script-fu/scripts/[3a-c]*.scm: push and pop a context.
Removed code that used to restore the context values changed by
the scripts.
2004-09-22 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in-proc-frame.[ch] (plug_in_proc_frame_init):
removed assertion about proc_rec != NULL because that happens
when query()ing and init()int plug-ins.
Replaced "context" by "main_context" plus "context_stack".
* app/plug-in/plug-in-context.c: implement plug_in_context_push()
and plug_in_context_pop().
* app/plug-in/plug-in-message.c
* app/plug-in/plug-in-progress.c: changed accordingly.
* tools/pdbgen/pdb/context.pdb: use the return values of
plug_in_context_push() and _pop().
* app/pdb/context_cmds.c: regenerated.
* plug-ins/script-fu/scripts/test-sphere.scm: use
gimp-context-push and gimp-context-pop instead of remembering the
old values for FG, BG etc.
2004-09-22 Sven Neumann <sven@gimp.org>
* tools/pdbgen/Makefile.am
* tools/pdbgen/pdb/context.pdb: new files that will hold context
related PDB functions.
* tools/pdbgen/groups.pl
* app/pdb/Makefile.am
* app/pdb/context_cmds.c
* app/pdb/internal_procs.c
* app/pdb/progress_cmds.c
* libgimp/gimp_pdb.h
* libgimp/gimpcontext_pdb.[ch]: (re)generated.
* app/plug-in/Makefile.am
* app/plug-in/plug-in-context.[ch]: new files that will hold code
that implements a context stack in the plug-in's proc-frame.
* app/plug-in/plug-in.[ch]: new function plug_in_get_proc_frame().
* app/plug-in/plug-in-message.c
* app/plug-in/plug-in-progress.c: use the new function instead of
duplicating it all over the place.
2004-09-22 Michael Natterer <mitch@gimp.org>
* app/plug-in/Makefile.am
* app/plug-in/plug-in-proc.[ch]: removed...
* app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name.
* app/plug-in/plug-in-def.[ch]
* app/plug-in/plug-in-message.[ch]
* app/plug-in/plug-in-progress.[ch]
* app/plug-in/plug-in-rc.[ch]
* app/plug-in/plug-in-run.[ch]
* app/plug-in/plug-in.[ch]
* app/plug-in/plug-ins.[ch]
* app/actions/plug-in-actions.c
* app/actions/plug-in-commands.c
* app/file/file-open.[ch]
* app/file/file-save.[ch]
* app/file/file-utils.[ch]
* app/gui/gui-vtable.c
* app/menus/plug-in-menus.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpfileprocview.c
* app/widgets/gimppluginaction.c
* app/xcf/xcf.c
* tools/pdbgen/pdb/fileops.pdb
* tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some
minor cosmetic cleanups.
* app/pdb/fileops_cmds.c
* app/pdb/plug_in_cmds.c: regenerated.
2004-09-22 Michael Natterer <mitch@gimp.org>
* app/widgets/gimplayertreeview.c
(gimp_layer_tree_view_floating_selection_changed): removed the
hack that was displaying "Floating Selection" instead of the
floating layer's real name.
* app/core/gimplayer.c: implement GimpViewable::get_description()
instead and special case floating selections with a two-line
text that contains "Floating Selection".
* app/core/gimplayer-floating-sel.c
* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
when it changes its state from floating to normal or vice versa
so the views can update accordingly.
* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.
* app/tools/gimpeditselectiontool.c:
s/"Floating Layer"/"Floating Selection"/.
2004-09-22 Michael Natterer <mitch@gimp.org>
* app/plug-in/Makefile.am
* app/plug-in/plug-in-proc-frame.[ch]: new files containing
utility functions for initializing/freeing PlugInProcFrames.
Added the progress stuff to the proc_frame.
* app/plug-in/plug-in.[ch]: removed the progress stuff from the
PlugIn struct and use the new proc_frame utility functions.
* app/plug-in/plug-in-message.c
* app/plug-in/plug-in-progress.c
* app/plug-in/plug-in-run.c: changed accordingly.
2004-09-22 Michael Natterer <mitch@gimp.org>
Prepare for enabling private contexts for plug-ins and scripts:
* app/plug-in/plug-in.[ch]: removed the "context" member from
the PlugIn struct and added it to PlugInProcFrame instead.
* app/plug-in/plug-in-message.c
* app/plug-in/plug-in-progress.c
* app/plug-in/plug-in-run.c: changed accordingly.
2004-09-22 Sven Neumann <sven@gimp.org>
* plug-ins/common/bumpmap.c: moved the preview to the left.
2004-09-22 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in-types.h
* app/plug-in/plug-in.[ch]: added struct PlugInProcFrame which
contains the ProcRecord, the proc's GMainLoop and its return
values.
Use the same struct for the plug-in's main proc and its
temp_procs, so we finally have one set of return values per call
frame, and not just one per plug-in.
Added plug_in_proc_frame_push()/pop() and changed
plug_in_main_loop[_quit]() accordingly.
* app/plug-in/plug-in-message.c
* app/plug-in/plug-in-progress.c
* app/plug-in/plug-in-run.c: changed accordingly.
2004-09-22 Sven Neumann <sven@gimp.org>
* app/text/gimptextlayout.c (gimp_text_get_pango_context):
workaround Pango bug #143542 (PangoFT2Fontmap leak, see also bug
#148997). Based on a patch by Robert Ögren.
2004-09-22 Sven Neumann <sven@gimp.org>
* app/widgets/gimpviewabledialog.c: removed the prelit event box
from the header frame, use a smaller font for the subtitle,
removed the separator.
* app/dialogs/preferences-dialog.c: removed the prelit event box
from the header frame. Perhaps we should have subtitles here with
a more verbose description of the settings page?
2004-09-21 Michael Natterer <mitch@gimp.org>
* app/actions/file-actions.c (file_actions): resolved conflicting
mnemonics.
2004-09-21 Sven Neumann <sven@gimp.org>
* data/images/Makefile.am (imagedata_DATA): renamed gimp_splash.png
to gimp-splash.png.
* data/images/gimp-splash.png: new splash, courtesy of Dave Neary.
* app/gui/splash.c: look for gimp-splash.png in the users
directory, then in the systemwide images directory.
2004-09-21 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-server.c: got rid of two the global
file descriptor sets. Use the client hash-table instead.
2004-09-21 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-server.c: enabled build of the
Script-Fu server for the Win32 platform using the winsock API.
* plug-ins/script-fu/Makefile.am: link with -lwsock32 on Win32.
* plug-ins/script-fu/script-fu-console.c
* plug-ins/script-fu/script-fu.c
* plug-ins/script-fu/siod-wrapper.c: removed Win32 specific code
that isn't needed any longer.
2004-09-21 Michael Natterer <mitch@gimp.org>
For the sake of completeness, added a GUI for the hidden
"Open as Layer" feature:
* app/actions/file-actions.c
* app/actions/file-commands.[ch]: added "file-open-as-layer"
action and callback. Abuse the "gimage" field of GimpFileDialog to
indicate layer opening (it's otherwise unused for file-open).
* app/dialogs/file-open-dialog.c: if dialog->gimage is non-NULL,
open the selected files as layers for that image.
* app/widgets/gimphelp-ids.h: added GIMP_HELP_FILE_OPEN_AS_LAYER.
* menus/image-menu.xml.in: added it to the menu.
2004-09-21 Sven Neumann <sven@gimp.org>
* plug-ins/common/jpeg.c (save_dialog): let the dialog collapse
with the expander by making it not resizable.
2004-09-21 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-close.c
(gimp_display_shell_close_dialog): resolved a mnemonics collision.
2004-09-21 Dave Neary <bolsh@gimp.org>
* plug-ins/common/psd.c: Correctly set overlay, hard light and
soft light modes from .psd files. Fixes bug #153229.
2004-09-21 Sven Neumann <sven@gimp.org>
* plug-ins/common/svg.c (SVG_DEFAULT_RESOLUTION): set to 90dpi as
a workaround for bug #143300.
2004-09-20 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/imagemap/imap_cmd_guides.c
* plug-ins/imagemap/imap_default_dialog.c
* plug-ins/imagemap/imap_menu.c
* plug-ins/imagemap/imap_preferences.c
* plug-ins/imagemap/imap_tools.c: disabled functionality that doesn't
fully work yet. Bug #136713 now becomes an enhancement request.
2004-09-20 Sven Neumann <sven@gimp.org>
* plug-ins/common/bumpmap.c: added tooltips, enabled "Compensate
for darkening" by default, some minor cleanups.
2004-09-20 Michael Natterer <mitch@gimp.org>
* app/dialogs/dialogs-constructors.c: removed useless #includes.
2004-09-20 Michael Natterer <mitch@gimp.org>
* app/actions/buffers-commands.c
* app/actions/file-commands.c
* app/actions/layers-commands.c
* app/actions/plug-in-actions.c
* app/actions/tools-actions.c: removed useless #includes, cleanup.
2004-09-20 Michael Natterer <mitch@gimp.org>
* app/dialogs/dialogs.[ch] (dialogs_init): added GimpMenuFactory
parameter and removed inclusion on "menus/menus.h".
* app/menus/menus.[ch] (menus_init): added GimpActionFactory
parameter and removed inclusion of "actions/actions.h".
* app/gui/gui.c (gui_restore_callback): pass the factories to the
above functions.
2004-09-20 Sven Neumann <sven@gimp.org>
* configure.in: bumped version number to 2.1.6.
2004-09-20 DindinX <dindinx@gimp.org>
* plug-ins/common/deinterlace.c: added a preview. Not sure if it is
really useful...
2004-09-20 DindinX <dindinx@gimp.org>
* plug-ins/common/shift.c: added a preview.
2004-09-20 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcolorselect.c (gimp_color_select_xy_events):
removed "case GDK_CONFIGURE" because it's not needed and did
"break" instead of "return FALSE", causing random color changes
when resizing and initially showing the widget.
2004-09-20 Sven Neumann <sven@gimp.org>
* Made 2.1.5 release.
2004-09-20 Michael Natterer <mitch@gimp.org>
* app/Makefile.am (gimp_2_1_LDFLAGS): removed all -u hacks.
(gimp_2_1_LDADD)
(gimp_console_2_1_LDADD): reordered .a files correctly. The core
seems to be cleaned up enough to have proper dependencies now.
2004-09-20 Michael Natterer <mitch@gimp.org>
* app/actions/channels-commands.c
* app/actions/vectors-commands.c: removed massive code duplication
by factoring out the code that creates the "New Channel/Path" and
"Edit Channel/Path Attributes" dialogs out to utility functions.
GUI spacing and Code cleanup.
* app/actions/layers-commands.c: minor GUI spacing and code
cleanup.
2004-09-19 Sven Neumann <sven@gimp.org>
* app/base/tile-manager.c (tile_manager_get_memsize): count valid
tiles, not dirty ones.
2004-09-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/bumpmap.c: some tweaks to the dialog layout.
2004-09-19 Michael Natterer <mitch@gimp.org>
* app/actions/qmask-commands.c (qmask_invert_cmd_callback): is a
GtkRadioAction callback but behaved like a GtkToggleAction
callback. Fixes bug #152948.
2004-09-19 DindinX <dindinx@gimp.org>
* plug-ins/common/bumpmap.c: use a GimpDrawablePreview instead of a
very complicated homemade preview. Many small changes in the code
too, and some cleanups. I hope I didn't break anything.
2004-09-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimppaintoptions-gui.c: clean up ugliness introduced
by my previous commit -- no functional change.
2004-09-19 Sven Neumann <sven@gimp.org>
Improved undo memory calculation for paint operations (bug #153035):
* app/base/tile-manager.[ch] (tile_manager_get_memsize): added a
"gboolean sparse" parameter to get more accurate results for
sparse tile-managers.
* app/core/gimpbuffer.c
* app/core/gimpdrawable.c
* app/core/gimpimage-undo-push.c
* app/core/gimpimage.c
* app/core/gimplayer.c
* app/core/gimpprojection.c: changed accordingly.
2004-09-19 Sven Neumann <sven@gimp.org>
* app/dialogs/Makefile.am (libappdialogs_a_SOURCES): added authors.h.
2004-09-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimppaintoptions-gui.c: rearrange tool options as
described in bug #153014.
2004-09-19 Sven Neumann <sven@gimp.org>
* app/widgets/gimperrordialog.c (gimp_error_dialog_add): fixed
handling of too many error messages.
2004-09-19 Sven Neumann <sven@gimp.org>
Try to make floating selections more obvious:
* app/widgets/gimplayertreeview.c
(gimp_layer_tree_view_floating_selection_changed): always display
"Floating Selection" as the name for a floating selection.
* app/core/gimpselection.c (gimp_selection_float): call the new
layer "Selection" instead of "Floating Selection". This is what
will be displayed if the FS is turned into a layer.
* app/actions/layers-commands.c (layers_edit_layer_query): don't
special case floating selections here.
* app/core/gimplayer-floating-sel.c: cosmetics.
2004-09-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/postscript.c (ps_open): applied a patch by Peter
Kirchgessner that solves a problem with the recognition of the
bounding box. Fixes bug #152829.
2004-09-19 Sven Neumann <sven@gimp.org>
* libgimpcolor/gimprgb-parse.c (gimp_rgb_parse_hex): fixed gtk-doc
comment.
2004-09-18 Simon Budig <simon@gimp.org>
* libgimpwidgets/gimpcolorhexentry.c: Removed check for len % 3 == 0,
so that the entry accepts hex colors starting with "#" again.
Untabbified.
2004-09-18 Manish Singh <yosh@gimp.org>
* app/Makefile.am: remove LDFLAGS references to now private
file_open_dialog_show, file_open_location_dialog_show, and
file_save_dialog_show.
2004-09-18 Sven Neumann <sven@gimp.org>
* app/actions/qmask-commands.c
* libgimpcolor/gimprgb.c (gimp_rgba_distance): just some cleanup.
* app/core/gimpimage-qmask.c (gimp_image_set_qmask_color): always
set gimage->qmask_color regardless of the qmask state.
* libgimpwidgets/gimpcolorbutton.c (gimp_color_button_new): set
the type before setting the color.
2004-09-17 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcomponenteditor.c
(gimp_component_editor_renderer_update): use
gimp_component_editor_get_iter() instead of duplicating its code.
2004-09-17 Simon Budig <simon@gimp.org>
* app/widgets/gimpbrusheditor.[ch]: Added a slider for the
brush spacing to the brush editor. Should make it more obvious
how to change it.
2004-09-17 Sven Neumann <sven@gimp.org>
* app/core/gimp-edit.c (gimp_edit_paste): based on a patch from
Joao S. O. Bueno: Ensure that the pasted layer is always within
the image, if it fits and aligned at top left if it doesn't.
Fixes bug #142944.
2004-09-16 Sven Neumann <sven@gimp.org>
* INSTALL: updated.
2004-09-16 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_set_logarithmic):
applied a patch by Joao S. O. Bueno that fixes bug #152820.
2004-09-16 Dave Neary <bolsh@gimp.org>
* plug-ins/script-fu/scripts/burn-in-anim.scm: patch from Kevin
Cozens which reinstates corona. Fixes bug #142282.
2004-09-16 Michael Natterer <mitch@gimp.org>
* configure.in: depend on GLib >= 2.4.5 and GTK+ >= 2.4.4.
* app/gui/gui.c: changed accordingly.
* app/sanity.c: ditto. Added check for GLib and put each check
into its own utility function. Enabled #if 0'ed check for
FreeType >= 6.2.7.
* app/widgets/gimpactiongroup.c
* app/widgets/gimpcursor.c
* app/widgets/gimpselectiondata.c
* app/widgets/gimpuimanager.c
* app/widgets/gimpwidgets-utils.c: removed workarounds for library
versions we refuse to start with.
2004-09-16 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdnd.c (gimp_dnd_uri_list_dest_add): reverse
order of DND dests so "text/uri-list" is preferred again after my
DND change of 2004-06-29. Fixes dropping of multiple files.
2004-09-16 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcomponenteditor.[ch]: set the viewable
renderer's "renderer" property to NULL when clearing the
view to work around bug #149906.
2004-09-16 Sven Neumann <sven@gimp.org>
* app/core/gimpscanconvert.c (VALUE_TO_PIXEL): replaced a bitshift
with a binary and. Should be unnoticeably faster ;)
2004-09-16 Michael Natterer <mitch@gimp.org>
* app/pdb/procedural_db.c: removed #if 0'ed code, took assignments
out of if()-conditions, minor cleanup.
2004-09-16 Simon Budig <simon@gimp.org>
* app/core/gimpscanconvert.c: Implemented an own rendering
callback for libart and use it instead of art_gray_svp_aa().
This now handles non-antialiased scan conversions itself. It
also basically shows the way to implement a LUT for the
scan conversion.
2004-09-16 Sven Neumann <sven@gimp.org>
* app/dialogs/quit-dialog.c: removed code that isn't needed any
longer now that the dialog is a singleton.
2004-09-15 DindinX <david@dindinx.org>
* plug-ins/common/mblur.c: fix the preview for the zoom blur mode.
2004-09-15 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.c
(gimp_preview_area_[draw|blend|mask]): fixed code that handles
drawing outside of the preview area.
* plug-ins/common/unsharp.c (preview_update): draw the preview
directly from the pixel region.
2004-09-15 Manish Singh <yosh@gimp.org>
* modules/controller_linux_input.c: use guint16 instead of __u16.
Should fix bug #152746.
2004-09-15 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablepreview.[ch]
* libgimp/gimpui.def: renamed gimp_drawable_preview_draw() to
gimp_drawable_preview_draw_buffer() and added a rowstride
parameter. Added new functions gimp_drawable_preview_get_drawable()
and gimp_drawable_preview_draw_region().
* plug-ins/common/mblur.c: added a preview that uses the
shadow tiles as the preview buffer and draws using the new
gimp_drawable_preview_draw_region() API.
* plug-ins/common/photocopy.c
* plug-ins/common/softglow.c: use gimp_drawable_preview_draw_region().
* plug-ins/common/cartoon.c
* plug-ins/common/despeckle.c
* plug-ins/common/edge.c
* plug-ins/common/gauss.c
* plug-ins/common/grid.c
* plug-ins/common/neon.c
* plug-ins/common/noisify.c
* plug-ins/common/sel_gauss.c
* plug-ins/common/sharpen.c
* plug-ins/common/sobel.c
* plug-ins/common/spread.c
* plug-ins/common/struc.c
* plug-ins/common/unsharp.c
* plug-ins/common/wind.c: use gimp_drawable_preview_draw_buffer().
2004-09-15 Michael Natterer <mitch@gimp.org>
* app/widgets/gimphelp-ids.h: added help IDs for the drawable- and
vectors-visible and -liked actions as well as for the layer mask
property action.
* app/actions/drawable-actions.c
* app/actions/vectors-actions.c: use them.
* app/actions/layers-actions.c
* app/actions/layers-commands.[ch]: ditto. Use
GIMP_STOCK_TRANSPARENCY for all layer opacity actions. Replaced
"paint_mode" by "mode" in all action and function/variable names
because this is the layer mode, not a paint mode.
* app/actions/channels-commands.c
* app/actions/layers-commands.c
* app/actions/vectors-commands.c: set the "activates-default"
property on the name entry in all "New Foo" and "Edit Foo
Attributes" dialogs except in the "New Layer" dialog.
Addresses bug #148026.
* menus/image-menu.xml.in: added a (commented out) layer
properties menu containing all the new actions.
2004-09-15 Michael Natterer <mitch@gimp.org>
* app/actions/layers-actions.c
* app/actions/layers-commands.[ch]: added actions and callbacks
"layers-preserve-transparency" and
"layers-paint-mode-first,last,previous,next". Update the "active"
state of the recently added layer mask property actions in
layers_actions_update().
* app/actions/drawable-actions.c
* app/actions/drawable-commands.[ch]: added actions and callbacks
for "drawable-visible" and "drawable-linked". Fixes bug #152597.
* app/actions/vectors-actions.c
* app/actions/vectors-commands.[ch]: same here ("vectors-visible"
and "vectors-linked").
* app/widgets/gimplayertreeview.c
(gimp_layer_tree_view_preserve_button_toggled): flush the image
so the new actions are updated. Compress preserve_trans undos.
* menus/image-menu.xml.in: added the layer mask property actions
to the Layers/Mask submenu.
* menus/layers-menu.xml: reordered the mask property actions
to have the same order as in the image menu.
2004-09-15 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcontainertreeview.c
(gimp_container_tree_view_menu_position): improved the fix for bug
#152662 and removed trailing whitespace.
2004-09-15 Nathan Summers <rock@gimp.org>
* app/widgets/gimpcontainertreeview.c
(gimp_container_tree_view_menu_position): clamp the popup menu's Y
position to the visible area of the GtkTreeView. Fixes #152662.
2004-09-14 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpquerybox.c: set the "activates-default"
property on the entries in all query boxes so hitting "return"
confirms them. Addresses bug #148026.
2004-09-14 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpbufferview.c: simplified the code which deals
with the global_buffer's preview. The new buffer view renderer
does the aspect ratio magic all by itself now.
* app/actions/image-commands.h: removed trailing whitespace.
2004-09-14 Michael Natterer <mitch@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer
which knows how to preserve a GimpBuffer's aspect ratio if the
view's aspect ratio is different.
* app/widgets/gimpviewrenderer-utils.c
(gimp_view_renderer_type_from_viewable_type): use it for viewables
of type GimpBuffer. Fixes bug #152531
2004-09-14 Sven Neumann <sven@gimp.org>
* plug-ins/common/flarefx.c
* plug-ins/common/nova.c: embed the preview into a sunken frame
and put it into the upper left corner of the dialog.
2004-09-14 Sven Neumann <sven@gimp.org>
* app/dialogs/dialogs-constructors.[ch]
* app/dialogs/dialogs.c
* app/gui/gui.c: let the dialog factory handle the quit dialog
as singleton. Fixes bug #151914.
* app/dialogs/quit-dialog.c: added a warning here. We need a
container of dirty images for the above change to work correctly.
2004-09-13 Sven Neumann <sven@gimp.org>
* plug-ins/common/jpeg.c (save_dialog): make the "Save EXIF data"
toggle insensitive when no EXIF data is present (bug #140042).
* app/display/gimpdisplayshell-close.c: as suggested by the HIG,
ask the user to save the image when the last display is being
closed. Addresses some issues raised in bug #106726.
2004-09-13 Michael Natterer <mitch@gimp.org>
* app/app_procs.c (app_run): install the message handler for the
"Gimp-Dialogs" domain.
2004-09-13 Michael Natterer <mitch@gimp.org>
* app/actions/file-commands.c: resurrected file_open_dialog_show()
and file_save_dialog_show() as private utility functions to get
rid of code duplication.
2004-09-13 Michael Natterer <mitch@gimp.org>
Manage the file-save dialog using the dialog factory and stop
making menu items insensitive while it is open. Fixes bug #81407.
* app/dialogs/Makefile.am
* app/dialogs/file-dialog-utils.[ch]: removed these files.
* app/dialogs/file-save-dialog.[ch]: removed functions
file_save_dialog_show() and file_save_a_copy_dialog_show() and
changed internal function file_save_dialog_create() to
file_save_dialog_new().
* app/dialogs/dialogs.c
* app/dialogs/dialogs-constructors.[ch]: made it completely
managed by the dialog factory.
* app/actions/file-commands.c: create it using the dialog
factory. Attach it to the image so we open only one save
dialog per image.
* app/dialogs/file-open-dialog.c: added precondition checks
to file_open_dialog_new().
2004-09-13 Sven Neumann <sven@gimp.org>
* plug-ins/common/jpeg.c: some code cleanup.
2004-09-13 Michael Natterer <mitch@gimp.org>
* app/dialogs/file-open-dialog.[ch]: removed function
file_open_dialog_show() and changed internal function
file_open_dialog_create() to file_open_dialog_new().
* app/dialogs/dialogs.c
* app/dialogs/dialogs-constructors.[ch]: made it completely
managed by the dialog factory.
* app/actions/file-commands.c: create it using the dialog factory.
2004-09-13 Michael Natterer <mitch@gimp.org>
* configure.in
* app/Makefile.am: added new directory app/dialogs and link
libappdialogs.c into the gimp binary.
* app/gui/Makefile.am
* app/gui/gui-types.h
* app/gui/gui-vtable.c
* app/gui/gui.c
* app/gui/about-dialog.[ch]
* app/gui/authors.h
* app/gui/color-notebook.[ch]
* app/gui/convert-dialog.[ch]
* app/gui/dialogs-constructors.[ch]
* app/gui/dialogs.[ch]
* app/gui/file-dialog-utils.[ch]
* app/gui/file-new-dialog.[ch]
* app/gui/file-open-dialog.[ch]
* app/gui/file-open-location-dialog.[ch]
* app/gui/file-save-dialog.[ch]
* app/gui/grid-dialog.[ch]
* app/gui/info-dialog.[ch]
* app/gui/info-window.[ch]
* app/gui/module-browser.[ch]
* app/gui/offset-dialog.[ch]
* app/gui/palette-import-dialog.[ch]
* app/gui/preferences-dialog.[ch]
* app/gui/quit-dialog.[ch]
* app/gui/resize-dialog.[ch]
* app/gui/resolution-calibrate-dialog.[ch]
* app/gui/stroke-dialog.[ch]
* app/gui/tips-dialog.[ch]
* app/gui/tips-parser.[ch]
* app/gui/user-install-dialog.[ch]: removed these files...
* app/dialogs/Makefile.am
* app/dialogs/dialogs-types.h
* app/dialogs/*.[ch]: ...and added them here. Changed some
filenames like module-browser -> module-dialog.
* app/app_procs.c
* app/actions/actions-types.h
* app/actions/actions.c
* app/actions/dialogs-actions.c
* app/actions/dialogs-commands.c
* app/actions/dockable-commands.c
* app/actions/drawable-commands.c
* app/actions/edit-commands.c
* app/actions/file-commands.c
* app/actions/gradient-editor-commands.c
* app/actions/image-commands.c
* app/actions/layers-commands.c
* app/actions/palettes-commands.c
* app/actions/select-commands.c
* app/actions/templates-commands.c
* app/actions/templates-commands.h
* app/actions/vectors-commands.c
* app/actions/view-commands.c
* app/display/gimpdisplayshell-cursor.c
* app/display/gimpdisplayshell-title.c
* app/display/gimpdisplayshell.[ch]
* app/tools/gimpcroptool.c
* app/tools/gimpperspectivetool.c
* app/tools/gimprotatetool.c
* app/tools/gimpscaletool.c
* app/tools/gimpsheartool.c
* app/tools/gimptransformtool.[ch]
* app/tools/gimpvectortool.c
* app/widgets/gimpcolormapeditor.[ch]
* app/widgets/gimpcolorpanel.c
* app/widgets/gimpgradienteditor.[ch]
* app/widgets/gimppaletteeditor.[ch]
* app/widgets/gimptoolbox-color-area.c
* menus/toolbox-menu.xml.in
* tools/authorsgen/authorsgen.pl: changed accordingly.
2004-09-13 Michael Natterer <mitch@gimp.org>
Restore binary compatibility of the wire protocol that was
broken by the recent GPConfig changes:
* libgimpbase/gimpprotocol.[ch] (struct _GPConfig)
(_gp_config_read)
(_gp_config_write): argh, we can't use the two bytes padding
because that's just a binary compatible struct change, but inserts
two bytes into the byte stream that goes over the wire. Use the
first two bytes of the former "gdouble gamma" instead.
* app/plug-in/plug-in-run.c (plug_in_run)
* libgimp/gimp.c (gimp_config): changed accordingly.
2004-09-13 Sven Neumann <sven@gimp.org>
* app/widgets/gimphelp.c: simulate the behaviour of GNU gettext and
look at the LANGUAGE environment variable if the locale is not "C".
2004-09-13 Simon Budig <simon@gimp.org>
* app/tools/gimpcroptool.c: Fix trailing whitespace introduced by me.
/me hides embarrassed in a corner... :)
2004-09-13 Simon Budig <simon@gimp.org>
* app/tools/gimpcroptool.c: Fix warnings and coding style.
2004-09-12 Nathan Summers <rock@gimp.org>
* app/tools/gimpcroptool.c: disable crop and resize buttons while the
operation is being processed. Fixes #152372.
2004-09-12 Sven Neumann <sven@gimp.org>
* plug-ins/common/aa.c (aa_dialog): use a combo box for format
selection.
2004-09-12 Sven Neumann <sven@gimp.org>
* libgimp/gimppixelrgn.c: fixed gtk-doc comments, removed trailing
whitespace.
2004-09-12 DindinX <david@dindinx.org>
* libgimp/gimppixelrgn.c: some more fixes by nomis.
2004-09-12 DindinX <david@dindinx.org>
* libgimp/gimppixelrgn.c: nomis helped me to make some correction to
the documentation.
2004-09-12 DindinX <david@dindinx.org>
* libgimp/gimppixelrgn.c: more documentation.
2004-09-11 DindinX <david@dindinx.org>
* plug-ins/common/edge.c: added a default value (TRUE) for the
update_preview toggle.
* plug-ins/common/wind.c: ported to GimpPreviewArea, so the preview is
much more useful now.
2004-09-11 DindinX <david@dindinx.org>
* libgimp/gimppixelrgn.c: added some gtk-doc documentation to pixel
region related functions. (work in progress)
2004-09-11 Simon Budig <simon@gimp.org>
* app/widgets/gimpdialogfactory.[ch]: Added boolean parameter to
gimp_dialog_factories_toggle to make it possible to ensure a visible
toolbox.
* app/actions/dialogs-commands.c: Use the new parameter to ensure
toolbox visibility after the last image window closes.
* app/display/gimpdisplayshell-callbacks.c: Changed accordingly.
Fixes bug #137057 (the discussion is in bug #152285)
2004-09-11 DindinX <david@dindinx.org>
* plug-ins/common/edge.c: ported to GimpPreviewArea. 100 less lines of
code and much more features!
2004-09-11 DindinX <david@dindinx.org>
* plug-ins/common/oilify.c: some code cleanup and small optimisations.
2004-09-10 Sven Neumann <sven@gimp.org>
* plug-ins/common/xpm.c (query): fixed spelling.
2004-09-10 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimperrorconsole.c: fix typo
2004-09-10 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcolorselect.c: untabified, removed useless
inclusion of <gdk/gdkkeysyms.h>.
2004-09-10 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpcolorselect.c: ported to GimpPreviewArea.
Destroy the GdkGC in unrealize() instead of in finalize().
2004-09-10 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainertreeview-dnd.c
(gimp_container_tree_view_drop_status): always call
gdk_drag_status() before returning FALSE.
(gimp_container_tree_view_drag_motion): never return FALSE, an
impossible drop location is now reported by calling
gdk_drag_status() above. Always returning TRUE makes sure
gimp_container_tree_view_drag_leave() is called unconditionally
and can remove the scroll_timeout set in drag_motion().
Fixes bug #152193 and many other obscure DND crashes caused by the
scroll_timeout being invoked after the widget is destroyed.
2004-09-10 Sven Neumann <sven@gimp.org>
* plug-ins/common/xpm.c: improved PDB blurb and help. Very loosely
based on a patch attached to bug #151912.
2004-09-10 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_thumb):
also handle GRAY and GRAYA thumbnails.
* tools/pdbgen/pdb/drawable.pdb
* tools/pdbgen/pdb/image.pdb: corrected documentation for
_gimp_drawable_thumbnail() and _gimp_image_thumbnail().
* app/pdb/drawable_cmds.c
* app/pdb/image_cmds.c
* libgimp/gimpdrawable_pdb.c
* libgimp/gimpimage_pdb.c: regenerated.
2004-09-10 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.c: fixed positioning of the
navigation marker and handling of motion events.
2004-09-10 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.c
* libgimpwidgets/gimppreviewarea.c: documented new functions.
2004-09-09 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablepreview.c
* libgimpwidgets/gimppreview.[ch]: added a navigation popup
similar to the one in the image window. Needs some more work.
2004-09-09 DindinX <david@dindinx.org>
* libgimpwidgets/gimppreviewarea.c: added a utility function
gimp_preview_area_queue_draw(), which queue the right part of the
preview to be redrawn. And use it in all the drawing functions. This
fix a problem where the preview wasn't updated correctly after a
resize.
2004-09-09 Michael Natterer <mitch@gimp.org>
* plug-ins/common/cartoon.c
* plug-ins/common/despeckle.c
* plug-ins/common/gauss.c
* plug-ins/common/grid.c
* plug-ins/common/neon.c
* plug-ins/common/noisify.c
* plug-ins/common/photocopy.c
* plug-ins/common/sel_gauss.c
* plug-ins/common/sharpen.c
* plug-ins/common/sobel.c
* plug-ins/common/softglow.c
* plug-ins/common/spread.c
* plug-ins/common/struc.c
* plug-ins/common/unsharp.c: pack all drawable previews expanding.
Also did some general cleanups like consistently naming the dialog
variable "dialog" and the main vbox "main_vbox".
2004-09-09 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.[ch]: right-align the preview for RTL
layouts.
2004-09-09 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.[ch]: allow to set a maximum size
and center the preview area if its allocation extends the maximum.
* libgimpwidgets/gimppreview.[ch]: derive from GtkVBox, moved the
toggle button out of the table and put the table into an aspect
frame. Added an API to set the preview boundaries. Set the maximum
size of the GimpPreviewArea from that function.
* libgimpwidgets/gimpwidgets.def: added new entries.
* libgimp/gimpdrawablepreview.c: use gimp_preview_set_bounds().
* plug-ins/common/gauss.c: pack the preview widget so that it
resizes with the dialog.
2004-09-09 DindinX <david@dindinx.org>
* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_blend)
(gimp_preview_area_mask): optimized the case where both buffers have
the same alpha for a given pixel.
2004-09-09 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrenderervectors.c: purely cosmetic cleanup.
2004-09-09 Michael Natterer <mitch@gimp.org>
* app/widgets/gimppdbdialog.c (gimp_pdb_dialog_constructor): use
g_type_name(dialog_type) instead of just "pdb dialog" as name for
the dialog's private context.
2004-09-09 Michael Natterer <mitch@gimp.org>
* app/gui/convert-dialog.[ch] (convert_dialog_new): changed
GimpDisplay* parameter to GimpProgress* because that's what it's
used for.
* app/actions/image-commands.c (image_convert_cmd_callback):
changed accordingly.
* app/gui/convert-dialog.c: massively cleaned up internals. Use a
GimpViewableButton + GimpContainerEntry combo as in text options
for selecting the custom palette. Use a filtered container which
contains only palettes with a maximum of 256 colors.
Fixes bug #136574
2004-09-09 Michael Natterer <mitch@gimp.org>
* app/gui/file-open-location-dialog.[ch]: changed
file_open_location_dialog_show() to
file_open_location_dialog_new() and return the dialog.
* app/gui/dialogs.c
* app/gui/dialogs-constructors.[ch]: added a constructor for it
and let the dialog factory manage it entirely.
* app/actions/file-commands.c
(file_open_location_dialog_cmd_callback): use the dialog factory
to create it.
2004-09-09 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdialogfactory.c
(gimp_dialog_factory_dialog_new_internal): renamed parameter
"gboolean raise_if_found" to "return_existing" and added
additional parameter "gboolean present".
(gimp_dialog_factory_dialog_new)
(gimp_dialog_factory_dialog_raise)
(gimp_dialog_factory_dockable_new): pass both parameters (passing
"present" as "raise_if_found" was not quite correct).
2004-09-08 DindinX <david@dindinx.org>
* libgimpwidgets/gimppreviewarea.c: fixed a stupid typo.
2004-09-08 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_fill):
optimized solid color fills.
2004-09-08 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.c: factored out common code.
Reduced indentation level by closing a switch earlier.
2004-09-08 DindinX <david@dindinx.org>
* libgimpwidgets/gimppreviewarea.c: (gimp_preview_area_blend)
use gimp_preview_area_draw when the opacity is 0 or 255, instead of
duplicating code.
2004-09-07 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpwidgets.def: added new entries.
* libgimpwidgets/test-preview-area.c: fit output into 80 columns.
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw): some
code cleanup.
2004-09-07 DindinX <david@dindinx.org>
* libgimpwidgets/test-preview-area.c: added some tests for
gimp_preview_area_blend() and gimp_preview_area_mask().
2004-09-07 DindinX <david@dindinx.org>
* libgimpwidgets/gimppreviewarea.c
* libgimpwidgets/gimppreviewarea.h: added two functions:
gimp_preview_area_blend() to draw the blending of two buffers with
an opacity parameter, and gimp_preview_area_mask() to draw the
blending of two buffers, with a mask buffer. The code still needs some
polish, though.
* libgimp/gimpdrawablepreview.c
* libgimp/gimpdrawablepreview.h: use gimp_preview_area_mask() in
gimp_drawable_preview_draw(), so the previews are now much more
accurate (respecting the selection, if any).
Also made the buf parameter of gimp_drawable_preview_draw() a pointer
to constants.
2004-09-07 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell-draw.c
(gimp_display_shell_draw_grid): #define the constant crosshair
size for the INTERSECTION grid style instead of using an eeky
"const gint".
2004-09-07 Michael Natterer <mitch@gimp.org>
* app/gui/dialogs.c (toplevel_entries): added a foreign entry
"gimp-file-open-loaction-dialog".
* app/gui/file-open-location-dialog.c: register the dialog
with the toplevel dialog factory so it remembers its position.
2004-09-07 Michael Natterer <mitch@gimp.org>
* app/actions/context-actions.c
* app/actions/context-commands.[ch]: applied a heavily modified
patch from David Gowers which adds actions to modify the context's
paint_mode. Fixes bug #151471.
* menus/image-menu.xml.in: added them to the (commentd out)
"Context" submenu.
2004-09-07 Michael Natterer <mitch@gimp.org>
* plug-ins/common/edge.c: indentation and whitespace cleanup.
* plug-ins/common/struc.c: minor coding style issues.
2004-09-07 Michael Natterer <mitch@gimp.org>
* plug-ins/common/xwd.c (query): applied patch from Alan Horkan
which improves the blurb and help texts. Fixes bug #151912.
Unrelated: did coding style / indentation cleanup in the whole file.
2004-09-07 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri):
simplified the code that selects an image file by its URI.
2004-09-07 Simon Budig <simon@gimp.org>
* app/widgets/gimpviewrendererbrush.c: Added an indicator for
generated brushes. Pretty straightforward, suggestions for
improvements are welcome.
2004-09-06 DindinX <david@dindinx.org>
* plug-ins/common/struc.c: added a preview.
2004-09-06 Simon Budig <simon@gimp.org>
* app/tools/gimpcroptool.c: reordered info_dialog_hide() and
crop_tool_crop_image(), which avoids the repeated popping up
of the info dialog and avoids a crash.
Fixes bug #151712
2004-09-05 DindinX <david@dindinx.org>
* plug-ins/common/cartoon.c: use gimp_preview_invalidate() where
appropriate.
* plug-ins/common/photocopy.c: Added a preview.
2004-09-05 Sven Neumann <sven@gimp.org>
* configure.in: bumped version number to 2.1.5.
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select
the image file, not only the folder it lives in. Fixes bug #151638.
2004-09-05 DindinX <david@dindinx.org>
* plug-ins/common/cartoon.c: Added a preview.
2004-09-05 Simon Budig <simon@gimp.org>
* plug-ins/common/autocrop.c: fix handling of layers with an
offset. Resize the image before cropping when the covered area
of a layer is partially outside the image area. Make math more
comprehensible.
2004-09-05 Sven Neumann <sven@gimp.org>
* plug-ins/common/convmatrix.c
* plug-ins/common/smooth_palette.c
* plug-ins/flame/flame.c: renamed functions from doit() to
something less silly.
2004-09-05 Sven Neumann <sven@gimp.org>
* Made 2.1.4 release.
2004-09-05 Simon Budig <simon@gimp.org>
* tools/pdbgen/pdb/image.pdb: improved documentation for
gimp_image_resize_to_layers
* libgimp/gimp.def: added gimp_image_resize_to_layers
* app/pdb/image_cmds.c
* libgimp/gimpimage_pdb.c: regenerated
2004-09-05 Simon Budig <simon@gimp.org>
* app/core/gimpimage-resize.[ch]: Implement function to resize
the image to contain all layers completely. Untabified.
* app/actions/image-actions.c
* app/actions/image-commands.[ch]
* app/widgets/gimphelp-ids.h
* menus/image-menu.xml.in: Make it available in the GUI.
* tools/pdbgen/pdb/image.pdb: Make it available in the PDB.
* app/pdb/image_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpimage_pdb.[ch]: regenerated.
2004-09-04 DindinX <david@dindinx.org>
* plug-ins/common/noisify.c: ported to GimpDrawablePreview.
2004-09-04 Michael Schumacher <schumaml@cvs.gnome.org>
* libgimp/gimp.def
* libgimpbase/gimpbase.def
* libgimpwidgets/gimpwidgets.def: added the check(erboard) related
entries
2004-09-04 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.[ch]: pass a GdkEventButton to
gimp_preview_area_menu_popup().
* libgimpwidgets/gimppreview.c: implement GtkWidget::popup_menu().
2004-09-04 DindinX <david@dindinx.org>
* libgimpwidgets/gimppreview.c: Changed the way we attach the preview
area frame to the table so very small drawables don't cause a
malicious bug.
2004-09-04 DindinX <david@dindinx.org>
* plug-ins/common/sel_gauss.c: ported to GimpDrawablePreview.
2004-09-04 DindinX <david@dindinx.org>
* plug-ins/common/sharpen.c: ported to GimpDrawablePreview.
2004-09-03 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.[ch]: added
gimp_preview_area_menu_popup(). Not completely finished yet...
* libgimpwidgets/gimppreview.c: use the new function.
2004-09-03 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_set_drawable):
take care of setting the colormap for indexed drawables.
* libgimpwidgets/gimppreview.c (gimp_preview_area_event): pan with
the first mouse button only. We will need the other buttons.
2004-09-03 Sven Neumann <sven@gimp.org>
* plug-ins/common/grid.c: ported to GimpDrawablePreview.
2004-09-03 Sven Neumann <sven@gimp.org>
* plug-ins/common/plasma.c (plasma_dialog): left-align the preview.
* plug-ins/common/grid.c (dialog): pack the preview as in other
plug-in dialogs and embed it into a GtkFrame.
2004-09-03 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdevicestatus.c: removed "Configure input
devices" button. Fixes bug #150177.
2004-09-03 Simon Budig <simon@gimp.org>
* app/gui/info-window.c: Applied modified patch by Kevin Cozens
that implements a "Comments" tab in the image info dialog.
Fixes bug #151719.
2004-09-03 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): swapped light
and gray checks to get a checkerboard that matches the image window.
2004-09-03 Michael Natterer <mitch@gimp.org>
* libgimpbase/gimpprotocol.h (struct _GPConfig): replaced the
never used "gdouble gamma" with 8 reserved gint8 and stuffed two
gint8 behind "gint8 show_tool_tips" where they fit in in a binary
compatible way due to 32bit aligning of the following "gint32
min_colors". Use the latter ones for "check_size" and
"check_type".
* libgimpbase/gimpprotocol.c (_gp_config_read,write): changed
accordingly to pass the new stuff over the wire.
* app/plug-in/plug-in-run.c: ditto. Pass the transpareny values
from GimpDisplayConfig to plug-ins.
* libgimp/gimp.[ch] (gimp_config): remember the new config values.
(gimp_check_size,type): new functions returning the new config values.
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_init):
use the new values to configure preview->area accordingly.
2004-09-03 Sven Neumann <sven@gimp.org>
* libgimpbase/gimpchecks.h
* libgimpbase/gimplimits.h: moved check size and check color
defines. It makes a lot more sense to keep them in gimpchecks.h.
* libgimpbase/gimpchecks.c (gimp_checks_get_shades): documented.
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw):
added a sanity check so we don't crash if the drawable pointer
should ever be NULL here.
2004-09-02 Helvetix Victorinox <helvetix@gimp.org>
* app/composite/gimp-composite-*test.c: a regression test now
iterates over 8388625 pixels per pass.
* app/composite/gimp-composite-mmx.c
* app/composite/gimp-composite-sse.c
* app/composite/gimp-composite-sse2.c:
Ensured that a clobbered condition code register is reflected in
the clobbered register list for each asm() statement.
This should FIX bug #147013.
2004-09-03 Sven Neumann <sven@gimp.org>
* libgimpbase/Makefile.am
* libgimpbase/gimpchecks.[ch] added gimp_checks_get_shades().
* app/base/temp-buf.c
* app/display/gimpdisplayshell-render.c
* libgimpwidgets/gimppreviewarea.c: use the new function instead
of replicating these numbers in three different places.
2004-09-03 DindinX <david@dindinx.org>
* plug-ins/gimpressionist/*.c: made the code much more readable by
applying the gimp's coding standard (intentation, space, etc.), and
remove the GTK_DISABLE_DEPRECATED warnings, since these files don't use
any deprecated stuff anymore.
2004-09-02 Michael Schumacher <schumaml@cvs.gnome.org>
* libgimp/gimpui.def
* libgimpbase/gimpbase.def
* libgimpwidgets/gimpwidgets.def: added the preview and progress
related entries
2004-09-02 Michael Natterer <mitch@gimp.org>
* plug-ins/common/neon.c
* plug-ins/common/noisify.c
* plug-ins/common/sobel.c
* plug-ins/common/softglow.c
* plug-ins/common/spread.c
* plug-ins/common/unsharp.c: fixed various coding style and naming
issues and added some missing signal connections to update the new
previews.
2004-09-02 DindinX <david@dindinx.org>
* plug-ins/common/despeckle.c: don't assume the preview has always the
same size, and do the memory allocation in preview_update(). As a side
effect, this fix a segfault :-). Also save the preview toggle state
between invocations.
2004-09-02 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-render.c (check_combos): light and
dark check color were swapped for GIMP_CHECK_TYPE_GRAY_CHECKS.
* libgimpwidgets/gimppreviewarea.[ch]: added "check-size" and
"check-type" properties and draw the checkerboard accordingly.
2004-09-02 Sven Neumann <sven@gimp.org>
* app/base/base-enums.[ch]
* libgimpbase/gimpbaseenums.[ch]: moved GimpCheckSize and
GimpCheckType enums to libgimpbase. Correctly prefix the enum
values.
* app/base/temp-buf.c
* app/config/gimpdisplayconfig.c
* app/display/gimpdisplayshell-render.c
* app/pdb/fileops_cmds.c
* tools/pdbgen/pdb/fileops.pdb: changed accordingly.
2004-09-02 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/script-fu-interface.c (script_fu_ok)
* plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc):
use a GString for assembling the commands string instead of
g_sprintf()ing into a buffer. Removes the need for a separate loop
over all args to determine the buffer's length and makes the
remaining code smaller and more readable.
2004-09-02 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.[ch]: made gimp_preview_draw() public,
added some gtk-doc comments.
(gimp_preview_toggle_callback): immidiately invalidate the preview.
* plug-ins/common/gauss.c (gauss): fixed (and simplified) handling
of zero radii by using the new GimpPreview API.
2004-09-01 Helvetix Victorinox <helvetix@gimp.org>
* app/composite/gimp-composite-mmx.[ch]: Added
gimp_composite_addition_va8_va8_va8_mmx().
* app/composite/make-installer.py: Regression tests now include
printing the image type for each test.
* app/composite/gimp-composite-mmx-test.c
* app/composite/gimp-composite-regression.c
* app/composite/gimp-composite-sse-test.c
* app/composite/gimp-composite-sse2-test.c
* app/composite/gimp-composite-x86.h: regenerated.
2004-09-02 Sven Neumann <sven@gimp.org>
* plug-ins/common/borderaverage.c
* plug-ins/common/checkerboard.c
* plug-ins/common/diffraction.c
* plug-ins/common/illusion.c
* plug-ins/common/polar.c
* plug-ins/common/ripple.c
* plug-ins/common/spread.c
* plug-ins/common/video.c: don't pass run_mode to
gimp_rgn_iterator_new(), it's unused. Removes the need for it being
a global variable.
2004-09-01 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplay.c
* app/widgets/gimpprogressdialog.c: gracefully handle progress
calls after the widget is destroyed. Re-fixes bug #150194.
2004-09-01 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablepreview.[ch]
* libgimpwidgets/gimppreview.[ch]: always show the "Preview" check
button. Simplified the preview APIs, moved the "size" style
property to the GimpPreview class.
* etc/gtkrc: changed the example accordingly.
* plug-ins/common/despeckle.c
* plug-ins/common/gauss.c
* plug-ins/common/neon.c
* plug-ins/common/sobel.c
* plug-ins/common/softglow.c
* plug-ins/common/spread.c
* plug-ins/common/unsharp.c: follow change in GimpDrawablePreview API.
2004-09-01 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/script-fu-types.h (struct SFOption): changed
"guint history" to "gint history".
* plug-ins/script-fu/script-fu-interface.c: added callbacks for
string entries and combo boxes and connect *all* widgets to callbacks.
(script_fu_ok): don't touch the widgets at all but get the values
directly now that the callbacks correctly write them to their
structs.
(script_fu_reset): don't copy the default values manually but
simply set the default values on the widgets; their callbacks will
do the rest.
* plug-ins/script-fu/script-fu-scripts.c (script_fu_add_script):
added some line breaks and spaces to make it more readable.
2004-09-01 Michael Natterer <mitch@gimp.org>
* libgimp/Makefile.am
* libgimp/gimpui.h
* libgimp/gimpuitypes.h
* libgimp/gimpprogressbar.[ch]: new widget GimpProgressBar which
automatically redirects any progress calls to itself while
it exists.
* plug-ins/script-fu/script-fu-interface.c: removed all progress
callbacks and simply use a GimpProgressBar.
2004-09-01 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.[ch]: set a busy cursor while the
preview is being recalculated.
* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_original):
do nothing if there's no drawable.
2004-09-01 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): oops, swapped x
and y variables.
* libgimpwidgets/gimppreview.c: some minor changes, mainly cleanup.
2004-09-01 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/gimpfu.py
* plug-ins/pygimp/gimpmodule.c: Hacked up support for the new
progress interface. Emphasis on hacked.
* plug-ins/pygimp/gimpmodule.c: Wrapped gimp_extension_enable(). Minor
cleanups.
* plug-ins/pygimp/pygimp-image.c
* plug-ins/pygimp/pygimp-tile.c: Minor cleanups.
2004-08-31 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/plug-ins/gimpcons.py
* plug-ins/pygimp/plug-ins/pdbbrowse.py: remove deprecated mainloop
calls.
2004-09-01 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablepreview.c: increased default preview size to
150 pixels. Added a border of 2 pixels around the bounding box of
the selection.
* libgimpwidgets/gimppreview.[ch]: only show the GDK_FLEUR cursor
if there's something to pan. Set the correct page size on the
scrollbar adjustments.
2004-09-01 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.[ch]: added new function
gimp_preview_area_set_offsets().
* libgimpwidgets/gimppreview.c: use the new function to let the
checkerboard scroll with the preview.
2004-09-01 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.[ch]: delay the emission of the
"invalidated" signal using a timeout. Removed hack that used to
invalidate the preview on button-release.
* plug-ins/common/unsharp.c: no need to fiddle with the slider
update policies any longer.
2004-09-01 Sven Neumann <sven@gimp.org>
* app/widgets/gimpdialogfactory.[ch]: added a boolean parameter to
gimp_dialog_factory_dialog_new() to let the caller decide whether
the window should be presented or not.
* app/actions/dialogs-commands.c
* app/actions/image-commands.c
* app/actions/templates-commands.c
* app/gui/gui-vtable.c
* app/gui/gui.c
* app/widgets/gimpsessioninfo.c: changed accordingly. Do not let
gimp_dialog_factory_dialog_new() present the dialog if we need to
change it after creation. This avoids annoying resizes, noticeable
especially with the error dialog.
2004-08-31 Sven Neumann <sven@gimp.org>
* app/widgets/gimpdockable.c
* libgimp/gimpdrawablepreview.c: converted tabs to spaces.
2004-08-31 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablepreview.c: added a style property for the
minimum size.
* etc/gtkrc: show how to adjust the size of GimpDrawablePreviews.
2004-08-31 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdatafactoryview.c
(gimp_data_factory_view_activate_item): emit "clicked" on the
edit_button only if it exists and is sensitive. Fixes bug #151343.
2004-08-31 Manish Singh <yosh@gimp.org>
* app/plug-in/plug-in.c (plug_in_open): cast plug_in_recv_message
to GSourceFunc.
2004-08-31 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.c: handle the widget size dynamically.
Hide scrollbars when there's nothing to scroll.
* libgimp/gimpdrawablepreview.c: simplified a lot. The scrollbars
are handled completely in the GimpPreview widget now.
2004-08-31 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.c: removed the hardcoded preview size,
removed some redundant assertions.
2004-08-31 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/script-fu-scripts.[ch]: removed the GUI code...
Also did some minor cleanups.
* plug-ins/script-fu/script-fu-interface.[ch]: ...and added it here.
* plug-ins/script-fu/script-fu-types.h: new file keeping the
various struct defs needed by both the above files.
* plug-ins/script-fu/Makefile.am
* plug-ins/script-fu/siod-wrapper.c: changed accordingly.
2004-08-31 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback):
notify the "update" property on the preview, not the toggle.
2004-08-31 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreview.c: allow to pan the preview with all
mouse buttons. Set a cursor to indicate that panning is possible.
2004-08-31 DindinX <david@dindinx.org>
* libgimpwidgets/gimppreview.c
* libgimpwidgets/gimppreview.h: renamed the "updated" signal to
"invalidated" and the confusing "update" virtual function to "draw".
Gave the properties saner names, too.
Removed _get_width and _get_height functions in favor of a _get_size
one.
Added gimp_preview_invalidate function that emits the "invalidated"
signal if needed.
* libgimp/gimpdrawablepreview.c
* libgimp/gimpdrawablepreview.h: modified accordingly and fixed the
scrollbar range.
* plug-ins/common/despeckle.c
* plug-ins/common/gauss.c
* plug-ins/common/neon.c
* plug-ins/common/sobel.c
* plug-ins/common/softglow.c
* plug-ins/common/spread.c
* plug-ins/common/unsharp.c: modified accordingly.
2004-08-31 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/script-fu-scripts.c: removed the script title
label and moved the "About" button to the action_area. Minor
cleanups.
2004-08-31 Michael Natterer <mitch@gimp.org>
* app/core/gimpdrawable-transform.[ch]: added GimpProgress
parameter to gimp_drawable_transform_affine().
* tools/pdbgen/pdb/edit.pdb
* tools/pdbgen/pdb/transform_tools.pdb: show progress for "blend"
and all transform functions.
* app/pdb/edit_cmds.c
* app/pdb/transform_tools_cmds.c: regenerated.
2004-08-31 Sven Neumann <sven@gimp.org>
* plug-ins/common/curve_bend.c: don't use GDK_TOP_LEFT_ARROW
to restore the default cursor, simply pass NULL to
gdk_window_set_cursor().
2004-08-31 Michael Natterer <mitch@gimp.org>
* app/paint/gimppaintoptions.[ch]: added "GimpPaintInfo *paint_info"
member and construct property. Changed gimp_paint_options_new()
to take only a GimpPaintInfo parameter.
* app/core/gimpitem.c (gimp_item_stroke)
* app/core/gimppaintinfo.c (gimp_paint_info_new): changed accordingly.
* app/core/gimpchannel.c (gimp_channel_stroke)
* app/vectors/gimpvectors.c (gimp_vectors_stroke): use
paint_options->paint_info->paint_type directly instead of casting
to GimpToolOptions and using
tool_options->tool_info->paint_info->paint_type (eek). Fixes crash
when stroking via the PDB because newly created GimpToolOptions
instances have no "tool_info" pointer yet.
* tools/pdbgen/pdb/paint_tools.pdb: changed all paint PDB wrappers
accordingly.
* app/pdb/paint_tools_cmds.c: regenerated.
2004-08-31 Michael Natterer <mitch@gimp.org>
* app/config/gimpconfig.c (gimp_config_iface_duplicate): set
construct_param->foo, not construct_param*s*->foo, so we don't set
the first construct param again and crash.
2004-08-31 Michael Natterer <mitch@gimp.org>
* plug-ins/common/cubism.c: added "..." to the progress text.
2004-08-31 Michael Natterer <mitch@gimp.org>
* app/actions/file-actions.c (file_actions): added "..." to "Revert".
2004-08-31 Sven Neumann <sven@gimp.org>
* libgimp/gimpuitypes.h
* libgimpwidgets/gimpwidgetstypes.h: moved the GimpDrawablePreview
typedef to the header file that it belongs to.
* libgimp/gimpdrawablepreview.[ch]: minor include cleanups and
gtk-doc fixes.
2004-08-31 Sven Neumann <sven@gimp.org>
* plug-ins/common/gauss.c (gauss_dialog): update the preview when
the blur radius is being changed. gimp_coordinates_new() seems to
be broken though; there shouldn't be two signal connections needed
here.
2004-08-31 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablepreview.[ch]
* libgimpwidgets/gimppreview.[ch]: minor code cleanup, fixes to
gtk-doc comments and to the handling of object properties.
2004-08-31 DindinX <david@dindinx.org>
* libgimpwidgets/gimppreview.c
* libgimpwidgets/gimppreview.h: added a GimpPreview widget, abstract
base for a GimpDrawablePreview.
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpwidgets.h
* libgimpwidgets/gimpwidgetstypes.h: modified accordingly.
* libgimp/gimpdrawablepreview.c
* libgimp/gimpdrawablepreview.h: added a GimpDrawablePreview widget
to ease the use of previews by plug-ins.
* libgimp/Makefile.am
* libgimp/gimpui.h: Changed accordingly.
* plug-ins/common/despeckle.c
* plug-ins/common/gauss.c
* plug-ins/common/neon.c
* plug-ins/common/sobel.c
* plug-ins/common/softglow.c
* plug-ins/common/spread.c
* plug-ins/common/unsharp.c: use a GimpDrawablePreview with these
plug-ins.
2004-08-30 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in-progress.[ch]: added boolean return values
to plug_in_progress_install(), uninstall() and cancel(). Added
checks to make sure the installed progress_callback exists, has
the correct signature and was installed by this plug-in.
* tools/pdbgen/pdb/progress.pdb: use the return values to let the
PDB wrappers succeed/fail.
* app/pdb/progress_cmds.c: regenerated.
2004-08-30 Michael Schumacher <schumaml@cvs.gnome.org>
* libgimp/gimp.def: added gimp_progress_install &
gimp_progress_uninstall
2004-08-30 Sven Neumann <sven@gimp.org>
* libgimp/gimpregioniterator.c: document the fact that "run_mode"
is unused. Also did some code cleanup.
2004-08-30 Michael Natterer <mitch@gimp.org>
* libgimp/gimpregioniterator.c: always update the progress.
Makes all "run_mode" parameters useless.
2004-08-30 Michael Natterer <mitch@gimp.org>
* plug-ins/common/gauss.c: add "..." to the progress text.
2004-08-30 Sven Neumann <sven@gimp.org>
* libgimp/gimpprogress.c: added some gtk-doc comments, could be
improved further.
2004-08-30 Sven Neumann <sven@gimp.org>
* plug-ins/common/colortoalpha.c
* plug-ins/common/compose.c
* plug-ins/common/decompose.c
* plug-ins/common/film.c
* plug-ins/fits/fits.c: always use the progress API, not doing it
in non-interactive mode has always been wrong.
2004-08-30 Manish Singh <yosh@gimp.org>
* libgimp/gimpprogress.[ch] (gimp_progress_uninstall): return the
user_data pointer on uninstall. Eases language binding work.
2004-08-30 Sven Neumann <sven@gimp.org>
* libgimp/gimpbrushmenu.c (gimp_brush_select_preview_draw): fixed
drawing of brushes that extend beyond the preview.
2004-08-30 Sven Neumann <sven@gimp.org>
* app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set):
avoid excessive use of strdup() and strcmp(). The strings are all
constant anyway.
2004-08-30 Michael Natterer <mitch@gimp.org>
Brought the PDB progress into a working state. Fixes bug #6010,
addresses bugs #97266 and #135185 and unfortunately reopens bug
#150194 (will fix that later).
* libgimpbase/gimpbaseenums.h: added enum GimpProgressCommand.
* app/core/gimppdbprogress.c
* libgimp/gimpprogress.c: use the enum instead of integer
constants for the different progress commands. Cleanup.
* app/plug-in/plug-in-progress.c
* app/plug-in/plug-in-run.c
* app/plug-in/plug-in.c: switch back to real refcounting for
plug_in->progress (reopens bug #150194) and enabled the PDB
progress code.
* plug-ins/script-fu/script-fu-scripts.c: cleaned up the
progress stuff and the script-fu interface a bit.
* plug-ins/pygimp/gimpenums.py
* plug-ins/script-fu/script-fu-constants.c
* tools/pdbgen/enums.pl: regenerated.
2004-08-29 Manish Singh <yosh@gimp.org>
* app/plug-in/plug-in.c (plug_in_open): set can_recurse on the
recv_message watch, so we don't block on recursive calls to the
handler. plug_in_recv_message needs some refcounting help now
though.
2004-08-29 Helvetix Victorinox <helvetix@gimp.org>
* app/composite/gimp-composite-x86.h
* app/composite/gimp-composite-sse.c
* app/composite/gimp-composite-sse2.c: Fixed a bunch of
warnings due to bad type casting.
* app/composite/gimp-composite-mmx.c
* app/composite/gimp-composite-sse.c
* app/composite/gimp-composite-x86.h
* app/composite/gimp-composite-sse2.c:
The last changes to fix the the clobber registers bug #147013.
Commented out some dead code to be reviewed later.
2004-08-29 Michael Natterer <mitch@gimp.org>
Added an API to allow plug-ins to embed the progress for the
actions they trigger into their own GUI (attention: half-done and
broken code ahead...)
* app/core/Makefile.am
* app/core/core-types.h
* app/core/gimppdbprogress.[ch]: new object implementing dispatching
progress calls to a temporary PDB procedure in a plug-in.
* app/Makefile.am: force to link gimppdbprogress.o, bah!
* app/plug-in/plug-in-progress.[ch]: added API to install,
uninstall and cancel a PDB progress for this plug-in, but disabled
the implementation because it doesn't work yet.
* tools/pdbgen/pdb/progress.pdb: added pdb wrappers for the new
install, uninstall and cancel functions.
* libgimp/Makefile.am
* libgimp/gimp.h
* libgimp/gimpprogress.[ch]: added an API around the PDB progress
stuff.
* app/pdb/internal_procs.c
* app/pdb/progress_cmds.c
* libgimp/gimpprogress_pdb.[ch]: regenerated.
* plug-ins/script-fu/script-fu-scripts.c: use the new API to show
the progress in the script-fu dialog.
2004-08-29 Michael Schumacher <schumaml@cvs.gnome.org>
* libgimpwidgets/gimpwidgets.def: added
gimp_scale_entry_set_logarithmic
2004-08-29 Sven Neumann <sven@gimp.org>
* app/config/gimpconfigwriter.c: don't emit critical warnings
about a messed up state of GimpConfigWriter if the writer is
disabled because of a write error that occured earlier.
2004-08-29 DindinX <david@dindinx.org>
* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.
* app/core/core-enums.c: Regenerated.
* app/actions/dockable-actions.c
* app/config/gimpcoreconfig.c
* app/config/gimpcoreconfig.h
* app/config/gimpdisplayconfig.c
* app/config/gimpdisplayconfig.h
* app/core/gimpundo.c
* app/display/gimpnavigationeditor.c
* app/gui/dialogs.c
* app/gui/file-open-location-dialog.c
* app/tools/gimppaintoptions-gui.c
* app/tools/gimptextoptions.c
* app/widgets/gimpbrushselect.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpsessioninfo.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimpundoeditor.c
* app/widgets/gimpundoeditor.h
* app/widgets/gimpviewablebutton.c: Changed accordingly.
2004-08-28 Helvetix Victorinox <helvetix@gimp.org>
* app/composite/gimp-composite-sse.c
* app/composite/gimp-composite-sse2.c: More updates to accomodate
the clobber registers. Additional progress against bug #147013.
* app/composite/gimp-composite-sse.h: Fixed a bug where the wrong
manifest constant definition caused sse2 instructions to never be
compiled.
2004-08-28 Sven Neumann <sven@gimp.org>
* plug-ins/common/vpropagate.c (run): fixed confusion about which
mode to use when being run with last values (bug #151308).
2004-08-28 Simon Budig <simon@gimp.org>
* plug-ins/common/plugindetails.c: workaround to avoid a warning
by gcc about the use of "%c" in the format string for strftime.
2004-08-28 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao
S. O. Bueno which adds an API that allows to make the scale widget
of a GimpScaleEntry behave logarithmic. Fixes bug #149420.
* app/widgets/gimpbrusheditor.c: use the new functionality for the
radius control.
2004-08-28 Sven Neumann <sven@gimp.org>
* plug-ins/common/compose.c (compose_dialog): applied patch from
Markus Triska that improves which layers are choosen by
default (bug #148172).
2004-08-28 Sven Neumann <sven@gimp.org>
* app/core/gimpimage-contiguous-region.c
(find_contiguous_region_helper): applied a patch from Eric Cheung
that changes the function to use a GQueue to implement recursion
instead of recursive function calls. Fixes bug #151124.
* plug-ins/common/noisify.c (noisify_dialog): left-align the
preview.
2004-08-28 Sven Neumann <sven@gimp.org>
* app/widgets/gimphelp-ids.h
* app/widgets/gimptoolbox.c (toolbox_create_image_area): added a
help-id for the image area.
2004-08-27 Michael Natterer <mitch@gimp.org>
Moved the gimp_progress_init() and gimp_progress_update() PDB
functions to their own group because they don't belong to the
"Plug-In" namespace and will soon get more functions.
* tools/pdbgen/pdb/plug_in.pdb: removed the progress stuff...
* tools/pdbgen/pdb/progress.pdb: ...and added it here.
* tools/pdbgen/Makefile.am
* tools/pdbgen/groups.pl
* app/pdb/Makefile.am
* libgimp/Makefile.am: changed accordingly.
* app/pdb/progress_cmds.c
* libgimp/gimpprogress_pdb.[ch]: new generated files.
* app/pdb/internal_procs.c
* app/pdb/plug_in_cmds.c
* libgimp/gimp_pdb.h
* libgimp/gimpplugin_pdb.[ch]: regenerated.
2004-08-27 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainereditor.c
(gimp_container_editor_construct): call
gimp_container_editor_select_item() manually at construction time
so views show the initially selected object's state correctly
(e.g. the brush spacing). Fixes bug #151227.
2004-08-27 DindinX <david@dindinx.org>
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h: renamed these files to ...
* app/widgets/gimpnavigationview.c
* app/widgets/gimpnavigationview.h: to these.
And renamed the GimpNavigationPreview type to GimpNavigationView.
Hopefully, this is the last change in file names for the Preview->View
renaming process.
* app/display/gimpnavigationeditor.c
* app/widgets/Makefile.am
* app/widgets/widgets-types.h: Changed accordingly.
2004-08-26 Michael Natterer <mitch@gimp.org>
* app/core/gimpitem.[ch]: removed "gboolean use_default_values"
from GimpItem::stroke().
* app/core/gimpchannel.c
* app/core/gimpselection.c
* app/vectors/gimpvectors.c: changed accordingly.
2004-08-26 Michael Natterer <mitch@gimp.org>
* app/core/gimpitem.c (gimp_item_stroke): implement the whole
paint_options fiddling here instead of in each subclass and pass
either GimpStrokeOptions or GimpPaintOptions (instead of
GimpStrokeOptions or GimpPaintInfo) to GimpItem::stroke().
Also copied code (that needs to be abstracted to a utility
function) from the tool_manager which makes sure we really use the
global brush, pattern etc. if these options are checked in prefs.
Fixes bug #150716.
* app/core/gimpchannel.c (gimp_channel_stroke)
* app/vectors/gimpvectors.c (gimp_vectors_stroke): removed the
duplicated code mentioned above and simply use the paint_options
passed.
2004-08-26 DindinX <david@dindinx.org>
* app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is
really derived from GimpViewRenderer and not from
GimpViewRendererDrawable.
2004-08-26 DindinX <david@dindinx.org>
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrenderer-utils.h
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrendererlayer.h
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...
* app/widgets/gimpviewrenderer-utils.c
* app/widgets/gimpviewrenderer-utils.h
* app/widgets/gimpviewrendererbrush.c
* app/widgets/gimpviewrendererbrush.h
* app/widgets/gimpviewrendererdrawable.c
* app/widgets/gimpviewrendererdrawable.h
* app/widgets/gimpviewrenderergradient.c
* app/widgets/gimpviewrenderergradient.h
* app/widgets/gimpviewrendererimage.c
* app/widgets/gimpviewrendererimage.h
* app/widgets/gimpviewrendererimagefile.c
* app/widgets/gimpviewrendererimagefile.h
* app/widgets/gimpviewrendererlayer.c
* app/widgets/gimpviewrendererlayer.h
* app/widgets/gimpviewrenderervectors.c
* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.
* app/tools/gimppaintoptions-gui.c
* app/widgets/Makefile.am
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpview.c
* app/widgets/widgets-types.h
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 Sven Neumann <sven@gimp.org>
* app/sanity.c (sanity_check_filename_encoding): try to convert
the result of gimp_directory() to UTF-8 and bail out with a
moderately helpful error message if this conversion fails. Works
around bug #150917. Also marked these strings for translation.
2004-08-26 Sven Neumann <sven@gimp.org>
* app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
as the default tool as suggested in bug #151091.
2004-08-26 DindinX <david@dindinx.org>
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h
* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: really removed these files from
cvs.
2004-08-25 Manish Singh <yosh@gimp.org>
* plug-ins/common/gifload.c: Guard against bogus logical screen
dimensions. Fixes bug #151053.
2004-08-26 DindinX <david@dindinx.org>
* app/widgets/gimppreview-popup.c
* app/widgets/gimppreview-popup.h: renamed these files...
* app/widgets/gimpview-popup.c
* app/widgets/gimpview-popup.h: .. to these files, and changed the
GimpPreviewPopup type to GimpViewPopup.
* app/widgets/gimppreviewrenderer.c
* app/widgets/gimppreviewrenderer.h: renamed these files...
* app/widgets/gimpviewrenderer.c
* app/widgets/gimpviewrenderer.h: .. to these files, and changed
GimpPreviewRenderer to GimpViewRenderer.
This is the second step of the great Preview->View renaming process.
* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationeditor.c
* app/widgets/Makefile.am
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcellrendererviewable.c
* app/widgets/gimpcellrendererviewable.h
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainerentry.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainerview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimppreviewrenderer-utils.c
* app/widgets/gimppreviewrendererbrush.c
* app/widgets/gimppreviewrendererbrush.h
* app/widgets/gimppreviewrendererdrawable.c
* app/widgets/gimppreviewrendererdrawable.h
* app/widgets/gimppreviewrenderergradient.c
* app/widgets/gimppreviewrenderergradient.h
* app/widgets/gimppreviewrendererimage.c
* app/widgets/gimppreviewrendererimage.h
* app/widgets/gimppreviewrendererimagefile.c
* app/widgets/gimppreviewrendererimagefile.h
* app/widgets/gimppreviewrendererlayer.c
* app/widgets/gimppreviewrenderervectors.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimptoolview.c
* app/widgets/gimpview.c
* app/widgets/gimpview.h
* app/widgets/gimpviewablebutton.c
* app/widgets/widgets-enums.h
* app/widgets/widgets-types.h: Modified accordingly.
2004-08-25 Sven Neumann <sven@gimp.org>
* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
adding message boxes and redirect messages to stderr if there are
too many messages.
2004-08-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/ggr.txt: fix incorrect statement, add note re SVG.
2004-08-25 Sven Neumann <sven@gimp.org>
* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
GimpMessageBox for each message added. Fixes bug #92604.
* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
functionality.
* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.
* app/gui/dialogs-constructors.[ch]
* app/gui/dialogs.c: manage GimpErrorDialog as singleton.
* app/gui/gui-vtable.c (gui_message): use the new error dialog.
* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
domain.
* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
when being called with a NULL domain.
2004-08-25 DindinX <david@dindinx.org>
* app/display/gimpnavigationeditor.[ch]: eradicate some more previews
in favor of views.
2004-08-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/Makefile.am
* devel-docs/ggr.txt: added new file decribing the ggr (Gimp
gradient) file format.
2004-08-25 DindinX <david@dindinx.org>
* app/display/gimpnavigationview.c
* app/display/gimpnavigationview.h: renamed these files to...
* app/display/gimpnavigationeditor.c
* app/display/gimpnavigationeditor.h: ... these files, and of course
changed GimpNavigationView to GimpNavigationEditor since it is really
inherited from GimpEditor anyway.
This will leave the gimp_navigation_view namespace for the renaming
from gimp_navigation_preview.
* app/display/Makefile.am
* app/display/display-types.h
* app/display/gimpdisplayshell-callbacks.c
* app/gui/dialogs-constructors.c: Changed accordlingly.
2004-08-25 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell-title.c
(gimp_display_shell_format_title): print bad '%' sequences
literally instead of warning (g_warning() is for programming
errors only and must never be triggered by bad or intermediate
user input). Fixes bug #150676
2004-08-24 Sven Neumann <sven@gimp.org>
* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
layouts.
* app/display/gimpdisplayshell-close.c
* app/gui/quit-dialog.c: use a GimpMessageBox.
2004-08-24 Sven Neumann <sven@gimp.org>
* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
Modeled after the proposed new API for GtkMessageDialog.
* app/widgets/gimpwidgets-utils.c: changed accordingly.
2004-08-24 DindinX <david@dindinx.org>
* app/widgets/gimppreview.c
* app/widgets/gimppreview.h: renamed these two files to...
* app/widgets/gimpview.c
* app/widgets/gimpview.h: ... these files.
Also renamed GimpPreview to GimpView.
This is the first step of the great Preview->View renaming process.
* app/actions/palettes-commands.c
* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpnavigationview.c
* app/gui/palette-import-dialog.c
* app/tools/gimppaintoptions-gui.c
* app/widgets/Makefile.am
* app/widgets/gimpaction.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainergridview.h
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdockbook.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpnavigationpreview.c
* app/widgets/gimpnavigationpreview.h
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppreview-popup.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptoolbox-image-area.c
* app/widgets/gimptoolbox-indicator-area.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpviewabledialog.c
* app/widgets/widgets-types.h: changed accordingly.
2004-08-24 Sven Neumann <sven@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.
* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
2004-08-23 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
the filename if gtk_file_chooser_set_uri() failed.
* app/actions/file-commands.c
* app/gui/file-save-dialog.c: trivial cleanups.
* app/widgets/gimpwidgets-utils.c: removed an unused extern
variable declaration.
2004-08-23 DindinX <david@dindinx.org>
* app/tools/tools-utils.c: fixed a typo that broke the build.
2004-08-22 Sven Neumann <sven@gimp.org>
* app/tools/Makefile.am
* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),
* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().
* app/tools/gimppainttool.c: changed accordingly.
* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
instead of duplicating that functionality.
* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
instead of implementing completely different constraints.
2004-08-22 Simon Budig <simon@gimp.org>
* app/vectors/gimpbezierstroke.c: Implemented the ellipse basic
shape differently to avoid possible rounding issues with
the _arcto () command.
* app/vectors/gimpvectors-import.c: properly close the rounded
rectangles.
2004-08-21 Sven Neumann <sven@gimp.org>
* app/vectors/gimpvectors-import.c (parse_svg_transform): support
optional center coordinates for the "rotate" transformations.
(parse_svg_transform): apply transformations in reverse order. The
SVG spec is rather confusing here.
2004-08-21 Sven Neumann <sven@gimp.org>
* app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed
a bug I introduced with my last commit.
* app/vectors/gimpvectors-import.c: added support for the basic
SVG shape "rect". Fixed handling of SVG lengths in basic shapes.
2004-08-21 Sven Neumann <sven@gimp.org>
* app/vectors/gimpbezierstroke.[ch]: added new function
gimp_bezier_stroke_new_ellipse() that provides a simple API to
create a bezier stroke that represents an ellipse.
* app/vectors/gimpvectors-import.c: added support for the basic
SVG shapes "circle" and "ellipse".
2004-08-21 Simon Budig <simon@gimp.org>
* plug-ins/common/gih.c: Fix some GUI issues. Make the relation
between the dimension parameter and the rank thingies more clear
also changed to a nicer layout.
2004-08-21 Sven Neumann <sven@gimp.org>
* app/vectors/gimpvectors-import.c: added support for the basic
SVG shapes "polyline" and "polygon".
2004-08-21 Sven Neumann <sven@gimp.org>
* app/vectors/gimpvectors-import.c: added support for importing
the basic SVG shape "line". Other shapes will follow...
2004-08-21 Sven Neumann <sven@gimp.org>
* app/actions/layers-actions.[ch]
* app/actions/layers-commands.[ch]
* app/widgets/gimplayertreeview.c: added actions to handle layer
masks as suggested in bug #150446.
* menus/layers-menu.xml: added menu entries for new actions,
commented out raise/lower menu entries.
2004-08-20 Sven Neumann <sven@gimp.org>
* modules/controller_linux_input.c: declare local function as static.
2004-08-19 Michael Schumacher <schumaml@cvs.gnome.org>
* plug-ins/common/guillotine.c: modified the coordinate insertion
into the file name to leave the file extension intact, changed the
format of the coordinates. Fixes bug #101901.
2004-08-18 Manish Singh <yosh@gimp.org>
* app/widgets/gimpcellrendereraccel.c
* app/widgets/gimphistogrambox.c
* plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts.
2004-08-18 Sven Neumann <sven@gimp.org>
* app/gui/color-notebook.c: no need to set a size_request here.
* libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.
* libgimpwidgets/gimpcolorscales.c
* modules/colorsel_cmyk.c: don't set a minimum width on the color
scales. Improves behaviour for narrow color dockables.
2004-08-18 Sven Neumann <sven@gimp.org>
* modules/colorsel_triangle.c: fixed crashes that occured with
small sizes, some code cleanups and a simple optimization.
2004-08-18 Sven Neumann <sven@gimp.org>
* app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.
* app/widgets/gimpdock.c
* app/widgets/gimpdockable.c: help-ids are never used directly,
use the defines from app/widgets/gimphelp-ids.h instead.
2004-08-17 Simon Budig <simon@gimp.org>
* modules/colorsel_triangle.c: Made the triangle colorselector
resizeable. Removed minimum size request (would probably need some
testing for *very* small sizes though).
2004-08-17 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimpdock.c
* app/widgets/gimpdockable.c: add help-ids.
2004-08-17 Sven Neumann <sven@gimp.org>
* app/plug-in/plug-in-progress.c (plug_in_progress_start): reset
the "cancel" signal handler id when a new progress is set.
2004-08-17 Sven Neumann <sven@gimp.org>
* modules/colorsel_cmyk.c: minor cleanups.
* modules/colorsel_water.c: let the widget take the available
space, don't set a minimum size.
2004-08-17 Sven Neumann <sven@gimp.org>
* app/plug-in/plug-in-progress.c
* app/plug-in/plug-in-run.c
* app/plug-in/plug-in.c: don't keep a strong reference to the
GimpProgress object, instead use a weak reference and deal with
the progress being destroyed while the plug-in is running.
Fixes bug #150194.
2004-08-16 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed
labels in CMYK mode. Fixes bug #150213.
2004-08-16 DindinX <david@dindinx.org>
* plug-ins/common/iwarp.c: fixed a typo preventing the preview to be
redrawn correctly in some case. Reported by AndyFitz.
2004-08-15 Sven Neumann <sven@gimp.org>
* modules/colorsel_triangle.c: minor cleanups.
* modules/colorsel_water.c: GimpPreviewArea seems like overkill
here, use a GtkDrawingArea instead.
2004-08-15 DindinX <david@dindinx.org>
* modules/colorsel_triangle.c
* modules/colorsel_water.c: Replaced the GtkPreviews by
GimpPreviewAreas.
2004-08-14 Manish Singh <yosh@gimp.org>
* libgimpbase/gimpprotocol.c (_gp_params_read): make sure array
length values are not negative, to prevent bad calls to g_new.
Addresses bug #150154.
2004-08-14 Sven Neumann <sven@gimp.org>
* plug-ins/help/Makefile.am: no need to link gimp-help-lookup with
any GIMP libraries.
* plug-ins/help/domain.[ch]: allow to specify the location of the
index files independently from the base URL.
* plug-ins/help/help.c: changed accordingly.
* plug-ins/help/gimp-help-lookup.c: added command-line options to
specify base URI and root directory for index files.
2004-08-14 Sven Neumann <sven@gimp.org>
* plug-ins/help/locales.c (locales_parse): don't mess up the order
of languages.
* plug-ins/help/gimp-help-lookup.c: parse command-line options,
added --help output.
2004-08-14 Sven Neumann <sven@gimp.org>
* plug-ins/help/help.[ch]: moved some defines to the header file.
* plug-ins/help/domain.c: trivial change to remove the libgimpbase
dependency.
* plug-ins/help/Makefile.am
* plug-ins/help/gimp-help-lookup.c: added a very simple
command-line tool that allows to lookup a help-id.
2004-08-13 DindinX <david@dindinx.org>
* plug-ins/common/edge.c: update the preview when the user choose a
different algorithm from the combo box. This was one of the main
reasons to have a preview here, after all.
2004-08-13 Sven Neumann <sven@gimp.org>
* plug-ins/common/edge.c (edge_dialog): use a combo box instead of
too many radio buttons.
2004-08-12 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new):
make sure that all actions, even if they have no menu proxy, can
be invoked by their accelerators. Fixes bug #149938.
* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
removed the same code here.
* app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new
function which disconnects from "accel_changed" of the accel_group
before upchaining (== before emitting "destroy").
The above changes make this one redundant, but since the crash in
bug #149938 was triggered by "accel_changed" emitted in the middle
of g_object_unref(tree_model), it feels better to be paranoic here
(fiddling with objects in destruction is no fun).
(gimp_action_view_accel_edited): don't warn if assigning the same
accel to the same action again.
(gimp_action_view_new): don't leak all accel_closures.
2004-08-12 DindinX <david@dindinx.org>
* plug-ins/common/edge.c: added a preview.
2004-08-12 Sven Neumann <sven@gimp.org>
* plug-ins/common/sel_gauss.c
* plug-ins/common/unsharp.c: place the preview widget into the
upper left corner like all other plug-ins do.
* plug-ins/help/domain.c: added some (disabled) debug output.
2004-08-12 DindinX <david@dindinx.org>
* plug-ins/common/sel_gauss.c: added a preview.
* plug-ins/common/unsharp.c: removed unused variables.
2004-08-12 Sven Neumann <sven@gimp.org>
* app/actions/context-actions.c: changed the icons to indicate
what part of the context is affected by the action. Looks better
in the shortcut editor.
2004-08-11 Michael Natterer <mitch@gimp.org>
* plug-ins/common/cartoon.c
* plug-ins/common/neon.c
* plug-ins/common/photocopy.c
* plug-ins/common/softglow.c: added four new plug-ins contributed
by Spencer Kimball. Ported them from 1.2 to 2.1 APIs.
* plug-ins/common/plugin-defs.pl: added them here.
* plug-ins/common/mkgen.pl: removed tab insanity now that
libgimpoldpreview is gone.
* plug-ins/common/.cvsignore
* plug-ins/common/Makefile.am: regenerated.
2004-08-11 DindinX <david@dindinx.org>
Bad DindinX! Don't break the build!
* configure.in
* plug-ins/common/mkgen.pl
* plug-ins/common/plugin-defs.pl: removed libgimpoldpreview from
here too.
* plug-ins/common/Makefile.am: regenerated.
2004-08-11 DindinX <david@dindinx.org>
Removed the GimpOldPreview stuff. Die, crap, die!
* plug-ins/libgimpoldpreview/*: removed.
* plug-ins/Makefile.am
* plug-ins/common/Makefile.am: changed accordingly.
* plug-ins/common/max_rgb.c
* plug-ins/common/noisify.c
* plug-ins/common/tileit.c: removed last forgotten
#include "libgimpoldpreview.h".
2004-08-11 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainercombobox.[ch]
* app/widgets/gimpcontainertreeview.c: when removing the last item
from the view, manually clear all GimpCellRendererViewables'
"renderer" properties; otherwise we have stale GimpPreviewRenderers
with still-refed viewables hanging around in the cells.
Works around GTK+ bug #149906.
2004-08-11 Michael Natterer <mitch@gimp.org>
* app/core/gimp.c
* app/core/gimpimagefile.c: converted tabs to spaces, cosmetic
changes.
2004-08-11 DindinX <david@dindinx.org>
* plug-ins/common/waves.c: GimpPreviewArea-ified.
2004-08-11 Michael Natterer <mitch@gimp.org>
Restored sane sorting order for menus which are created
entirely by plug-ins (like Xtns/Script-Fu/...).
* app/menus/plug-in-menus.c (plug_in_menus_build_path): made it
return the built path. For each sub-menu created, add a "Menus"
placeholder and a separator. Make sure all sub-menus end up in the
"Menus" placeholder. More readable because we can use the path
returned by the recursive invocation now.
(plug_in_menus_add_proc): simplified by using the path
plug_in_menus_build_path() returns.
2004-08-11 Michael Natterer <mitch@gimp.org>
* app/core/gimpprogress.[ch]: added virtual function
gboolean GimpProgressInterface::is_active().
* app/display/gimpdisplay.c
* app/display/gimpstatusbar.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpprogressbox.c
* app/widgets/gimpprogressdialog.c
* app/widgets/gimpthumbbox.c: implement it.
* app/plug-in/plug-in.h: removed "gboolean progress_active" and
added "gulong progress_cancel_id" instead.
* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
we correctly handle the "cancel" connections of progress instances
passed from other plug-ins.
2004-08-11 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in-message.c
* app/plug-in/plug-in-run.c (plug_in_temp_run)
* libgimp/gimp.c (gimp_temp_proc_run): removed ENABLE_TEMP_RETURN
#define and all code which was in #ifndef ENABLE_TEMP_RETURN.
2004-08-11 Michael Natterer <mitch@gimp.org>
* app/core/gimp-gui.[ch]: added "display_ID" to gimp_new_progress().
* app/gui/gui-vtable.c: changed accordingly.
* app/plug-in/plug-in-progress.[ch]: reenabled showing the
progress in a particular display.
2004-08-11 Michael Natterer <mitch@gimp.org>
* etc/controllerrc: added a commented-out midi controller entry
with some example mappings.
2004-08-11 DindinX <david@dindinx.org>
* plug-ins/common/plasma.c: converted to GimpPreviewArea.
2004-08-11 DindinX <david@dindinx.org>
* plug-ins/common/noisify.c: converted to GimpPreviewArea. Also added
scrollbars to move around. The preview was rather useless without
them.
2004-08-11 Michael Natterer <mitch@gimp.org>
* app/core/gimpdrawable-blend.c
* app/core/gimpprogress.c: some progress cleanup.
* app/display/gimpstatusbar.c (gimp_statusbar_progress_start): no
need to warn if there is already a progress active, just silently
return NULL as all other GimpProgressInterface implementors.
* app/plug-in/plug-in-progress.c: several progress fixes.
It's still a mess.
* plug-ins/common/url.c: don't show progress depending on
run_mode. Run the actual file plug-in with the same run_mode we
were invoked with.
2004-08-11 Sven Neumann <sven@gimp.org>
* app/gui/file-open-location-dialog.c
* app/widgets/gimpprogressbox.c: increased horizontal size request
to reduce resizing.
2004-08-11 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
fixed annoying resizing when thumbnailing exactly one image.
2004-08-11 Michael Natterer <mitch@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
a label and a progressbar. Implements GimpProgressIterface.
* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
by a GimpProgressBox. Delegate most progress functionality to it.
* app/widgets/gimpwidgets-utils.[ch]: factored out utility
function gimp_dialog_set_sensitive().
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
use it.
* app/gui/file-open-location-dialog.c (file_open_location_response):
embed the called file procedure's progress using a GimpProgressBox.
2004-08-10 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpfiledialog.[ch]
(gimp_file_dialog_set_sensitive): new function which works on all
widgets in the dialog except the cancel button.
Remember if the active progress is cancelable and added two
booleans "busy" and "canceled". Added GtkDialog::response()
implementation which, if the dialog is busy, cancels the active
progress and sets the dialog's "canceled" state.
Moved the progress bar right above the action area so it is next
to the cancel button and in the same place for both open and save
dialogs.
* app/gui/file-open-dialog.c
* app/gui/file-save-dialog.c: use the new API to make image loading
and saving cancelable again.
* app/widgets/gimpthumbbox.c: use the same stuff to make
thumbnailing cancelable. Increased the minimum height a bit so it
doesn't resize when the progress bars are shown.
2004-08-10 Michael Natterer <mitch@gimp.org>
Redid the whole internal progress stuff: don't pass around
progress_callback and progress_data; instead, provide a
pointer to a GimpProgressInterface which can be implemented
by a variety of backends.
Addresses (but not yet fixes) bugs #6010, #97266 and #135185.
* app/display/Makefile.am
* app/display/gimpprogress.[ch]: removed the old progress hack.
* app/core/Makefile.am
* app/core/core-types.h
* app/core/gimpprogress.[ch]: implement GimpProgressInterface.
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpprogressdialog.[ch]: the standalone progress
dialog as widget implementing GimpProgressInterface.
* app/display/gimpdisplay.c
* app/display/gimpstatusbar.[ch]
* app/widgets/gimpfiledialog.[ch]
* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
implementation to these classes.
* app/core/gimp-gui.[ch]
* app/gui/gui-vtable.c: replaced the old progress vtable entries
by two new to create and destroy a GimpProgressDialog in case
no other progress is available.
* app/pdb/procedural_db.[ch]
* app/plug-in/plug-in-run.[ch]
* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
all plug-ins.
* app/plug-in/plug-in.[ch]
* app/plug-in/plug-ins.c
* app/plug-in/plug-in-message.c
* app/plug-in/plug-in-progress.c: handle the case there the
plug-in was crated with a progress as well as the case where it
wasn't.
* app/app_procs.c
* app/batch.c
* app/xcf/xcf.c
* app/file/file-open.[ch]
* app/file/file-save.[ch]
* app/widgets/gimphelp.c
* app/widgets/gimpbrushselect.c
* app/widgets/gimpfontselect.c
* app/widgets/gimpgradientselect.c
* app/widgets/gimppaletteselect.c
* app/widgets/gimppatternselect.c: changed accordingly.
* app/core/gimpimagefile.[ch]
* app/display/gimpdisplayshell-dnd.c
* app/gui/file-open-dialog.c
* app/gui/file-open-location-dialog.c
* app/gui/file-save-dialog.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
related functions. Embed the progress in the file dialog where
possible.
* app/core/gimpdrawable-blend.[ch]
* app/core/gimpdrawable-transform.[ch]
* app/core/gimpimage-convert.[ch]
* app/core/gimpimage-flip.[ch]
* app/core/gimpimage-resize.[ch]
* app/core/gimpimage-rotate.[ch]
* app/core/gimpimage-scale.[ch]
* app/core/gimpitem-linked.[ch]
* app/core/gimpitem.[ch]
* app/core/gimpchannel.c
* app/core/gimpdrawable.c
* app/core/gimplayer.c
* app/core/gimpselection.c
* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.
* app/tools/gimpblendtool.c
* app/tools/gimptransformtool.c
* app/gui/convert-dialog.c
* app/actions/documents-commands.c
* app/actions/file-commands.c
* app/actions/image-commands.c
* app/actions/layers-commands.c
* app/actions/plug-in-commands.c
* app/actions/vectors-commands.c
* tools/pdbgen/pdb/convert.pdb
* tools/pdbgen/pdb/edit.pdb
* tools/pdbgen/pdb/image.pdb
* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.
* app/pdb/*_cmds.c: regenerated.
2004-08-10 DindinX <david@dindinx.org>
* plug-ins/common/blinds.c: GimpPreviewArea-ified.
2004-08-10 DindinX <david@dindinx.org>
* plug-ins/common/AlienMap2.c: Ported to GimpPreviewArea, use an enum
for the color model instead of some defines and use gboolean instead
of gint where appropriate.
2004-08-10 Sven Neumann <sven@gimp.org>
* app/core/gimpbrushgenerated.c (gimp_brush_generated_load):
plugged more file descriptor leaks.
2004-08-10 DindinX <david@dindinx.org>
* app/core/gimpbrushgenerated.c: don't leak a file descriptor when
reading a bad .vbr file.
2004-08-10 Sven Neumann <sven@gimp.org>
* plug-ins/common/unsharp.c: don't show progress on the image
window while updating the preview.
2004-08-09 Sven Neumann <sven@gimp.org>
* plug-ins/common/unsharp.c (unsharp_region): reset the progress
when done; some code cleanup.
2004-08-09 DindinX <david@dindinx.org>
* plug-ins/common/unsharp.c: continuously show the (original) image
during a scrollbar movement. This makes it easier to navigate.
2004-08-09 Michael Natterer <mitch@gimp.org>
Applied (slightly modified) patch from Shlomi Fish which adds a
progress bar to the RGB -> INDEXED conversion. Fixes bug #145274
and shows that we really really need a GimpProgressInterface in
the core to give progress users full access to the progress API.
* app/core/gimpimage-convert.[ch]: added special
GimpImageConvertProgress function typedef to cope with the
different stages of converting. Support passing such a callback &
data to gimp_image_convert() and update the progress accordingly.
* app/gui/convert-dialog.[ch]: added a convert progress callback
and pass it to gimp_image_convert().
* app/actions/image-commands.c
* tools/pdbgen/pdb/convert.pdb: changed accordingly.
* app/pdb/convert_cmds.c: regenerated.
2004-08-09 Sven Neumann <sven@gimp.org>
* data/misc/gimp.desktop.in.in: added GenericName and Version,
updated Categories.
2004-08-09 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-ins.c
(plug_ins_file_register_magic)
(plug_ins_file_register_mime): don't dereference
gimp->current_plug_in->plug_in_def if it's NULL.
Fixes bug #149678.
(plug_ins_file_register_mime): moved returning the proc_def inside
the right if() statement.
2004-08-09 Hans Breuer <hans@breuer.org>
* app/core/gimp-edit.c (gimp_edit_paste_as_new):
gimp_create_display() with the right parameters order
* app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons)
handle gtk_style_lookup_icon_set() returnig NULL
* app/gimpcore.def app/widgets/makefile.msc
themes/default/images/makefile.msc : updated
2004-08-09 Sven Neumann <sven@gimp.org>
* plug-ins/common/postscript.c (save_ps_header): use the basename
as Title, not the full filename. Fixes bug #149669.
2004-08-08 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/siod/sliba.c (array_prin1): when printing a
character array, don't flush the buffer for each byte but wait
until it is filled.
2004-08-08 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/siod-wrapper.[ch] (siod_output_string): use
g_strdup_vprintf() instead of guessing the string length. Also
declare the function using G_GNUC_PRINTF().
2004-08-08 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/ifscompose/README.ifscompose: fix out of date info,
pointed out by the author.
2004-08-08 Sven Neumann <sven@gimp.org>
* libgimpwidgets/Makefile.am: do not build test-preview-area by
default, put it into EXTRA_PROGRAMS. Fixes parallel builds.
2004-08-08 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_sensitive):
new function which checks a GimpImageType against the
proc_def->image_types_val mask.
* app/actions/plug-in-actions.c: use the new function here. Also
separated setting the "Repeat last" and "Reshow last" actions'
labels from setting their sensitivity and made them use the same
sensitivity logic as all other plug-in actions. Fixes bug #149567.
2004-08-07 Simon Budig <simon@gimp.org>
* libgimpwidgets/gimpcolorscales.c: emit the COLOR_CHANGED signal
when the hex entry is changed.
2004-08-07 Sven Neumann <sven@gimp.org>
* app/sanity.c: abort if the configured filename encoding can't be
converted to UTF-8. Fixes bug #149464 for the HEAD branch.
2004-08-07 Sven Neumann <sven@gimp.org>
* libgimp/gimpgradientmenu.c (gimp_gradient_select_preview_expose):
corrected dither offset.
2004-08-07 DindinX <david@dindinx.org>
* plug-ins/common/max_rgb.c: use a GimpPreviewArea instead of
GimpOldPreview.
2004-08-07 Sven Neumann <sven@gimp.org>
* libgimp/gimpgradientmenu.c: use a GtkDrawingArea instead of
GtkPreview.
* libgimp/gimpbrushmenu.c
* libgimp/gimppatternmenu.c: minor cleanup.
2004-08-07 DindinX <david@dindinx.org>
* plug-ins/common/jigsaw.c: ported to GimpPreviewArea, did some
cleanup and removed tabs.
2004-08-07 Sven Neumann <sven@gimp.org>
* configure.in: bumped version number to 2.1.4.
2004-08-07 DindinX <david@dindinx.org>
* plug-ins/common/illusion.c: ported to GimpPreviewArea.
2004-08-07 DindinX <david@dindinx.org>
* libgimpwidgets/gimppreviewarea.c: fixed the rendering for INDEXED
and INDEXEDA image types.
* plug-ins/common/grid.c: ported to GimpPreviewArea.
2004-08-06 DindinX <david@dindinx.org>
* plug-ins/common/glasstile.c: ported to GimpPreviewArea.
2004-08-06 DindinX <david@dindinx.org>
* plug-ins/common/nlfilt.c: ported to GimpPreviewArea.
2004-08-06 Michael Natterer <mitch@gimp.org>
* app/tools/gimptransformtool.h: removed the recently added
"gdouble aspect_ratio"...
* app/tools/gimpscaletool.[ch]: ...and added it where it belongs.
2004-08-06 Michael Natterer <mitch@gimp.org>
Transform tool cleanup:
* app/tools/gimptransformtool.[ch]: added new virtual function
GimpTransformTool::dialog_update().
Made wrapper for ::recalc() public and function
transform_bounding_box() private.
Call ::dialog_update() and transform_bounding_box() from the
::recalc() wrapper.
* app/tools/gimpperspectivetool.[ch]
* app/tools/gimprotatetool.[ch]
* app/tools/gimpscaletool.[ch]
* app/tools/gimpsheartool.[ch]: turned all info_dialog update
functions into GimpTransformTool::dialog_update() implementations
and don't call them from ::recalc(), also removed calls to
transform_bounding_box(); both functions are called by the parent
class now. Call gimp_transform_tool_recalc() when dialog values
were changed, not the tool's internal function.
Moved all static variables to the instance structs.
2004-08-06 Michael Natterer <mitch@gimp.org>
* app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari
Pollak which enables controlling the shear direction from the
dialog and changing the shear direction without hitting "Reset".
Fixes bug #149467.
Also moved all static variables to the GimpShearTool struct and
converted tabs to spaces.
2004-08-06 DindinX <david@dindinx.org>
* plug-ins/common/nova.c: ported to GimpPreviewArea.
2004-08-06 Sven Neumann <sven@gimp.org>
* Made 2.1.3 release.
2004-08-06 DindinX <david@dindinx.org>
* plug-ins/common/polar.c: ported to GimpPreviewArea (from
GimpOldPreview).
2004-08-06 Sven Neumann <sven@gimp.org>
* libgimpcolor/test-color-parser.c: include <glib-object.h>.
2004-08-06 Sven Neumann <sven@gimp.org>
* plug-ins/common/depthmerge.c:
* plug-ins/common/despeckle.c: removed unused variables.
2004-08-06 DindinX <david@dindinx.org>
* plug-ins/common/flarefx.c: ported to GimpPreviewArea (from
GimpOldPreview)
2004-08-06 Sven Neumann <sven@gimp.org>
* plug-ins/twain/Makefile.am (EXTRA_DIST): forgot to remove
tw_sess.c here.
2004-08-05 DindinX <david@dindinx.org>
* plug-ins/common/wind.c: ported to GimpPreviewArea (from
GimpOldPreview)
2004-08-05 Michael Natterer <mitch@gimp.org>
* app/tools/gimpiscissorstool.c: increased the handle size from 8
to 9 pixels (which is the same as in the path tool) as suggested
in bug #134250.
2004-08-05 Michael Natterer <mitch@gimp.org>
* app/display/gimpstatusbar.c: make the cursor coordinates label
insensitive when displaying out-of-image coordinates.
2004-08-05 Michael Natterer <mitch@gimp.org>
* app/config/gimprc-blurbs.h (INSTALL_COLORMAP_BLURB):
s/pseudocolor visuals/8-bit (256 colors) displays/.
Fixes bug #137078.
2004-08-05 Michael Natterer <mitch@gimp.org>
Enabled previewing items without selecting them in all list and
grid views using mouse button 2. Implicitly enables previewing of
items in container popups and thus fixes bug #121011:
* app/widgets/gimppreview.c (gimp_preview_button_press_event)
* app/widgets/gimpcellrendererviewable.c
(gimp_cell_renderer_viewable_clicked): show the preview also on
mouse button 2 click.
* app/widgets/gimpcontainertreeview.c
(gimp_container_tree_view_button_press): dispatch mouse button 2
clicks to GimpCellRendererViewable, but don't select or change
anything in the tree_view.
Unrelated cleanup:
* app/widgets/gimppreview.c (gimp_preview_button_press_event):
don't offset bevent->x,y by widget->allocation.x,y before calling
gimp_preview_popup_show() ...
* app/widgets/gimppreview-popup.c (gimp_preview_popup_show):
... instead, do it here generically (check if the parent widget is
GTK_WIDGET_NO_WINDOW()).
2004-08-05 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpintstore.c (gimp_int_store_add_empty):
allocate the empty_iter using g_new0(). Fixes valgrind warnings
about reads from uninitialized memory.
2004-08-05 Michael Natterer <mitch@gimp.org>
* app/actions/context-actions.c: use GTK_STOCK_JUMP_TO for
all "Set" actions (like context-foreground-red-set).
2004-08-05 Michael Natterer <mitch@gimp.org>
* app/tools/gimpscaletool.c
* app/tools/gimptransformtool.h: applied patch from Jordi Gay
(attached to bug #131111) which adds an aspect ratio spinbutton to
the scale dialog and keeps the aspect ratio intact when width or
height are changed using the dialog. Fixes bug #132274.
* app/tools/gimpcroptool.c
* app/tools/gimpscaletool.c: don't set the aspect spinbuttons to
"wrap" and decrease their climb_rate.
2004-08-05 Michael Natterer <mitch@gimp.org>
* app/actions/context-actions.c
* app/actions/context-commands.[ch]
* menus/image-menu.xml.in: added actions, callbacks and menu items
for the brush shape and spikes.
2004-08-04 Simon Budig <simon@gimp.org>
* plug-ins/common/grid.c: changed the default colors for the
first invocation to the current foregroud color which is more
likely to be useful than the blue shades.
2004-08-04 Sven Neumann <sven@gimp.org>
* themes/Default/images/Makefile.am
* themes/Default/images/stock-brush-generated-*-16.png: removed ...
* themes/Default/images/stock-shape-*-16.png: ... and added back
with more generic names.
* libgimpwidgets/gimpstock.[ch]
* app/widgets/gimpbrusheditor.c: changed accordingly.
* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
well.
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
editor widget factored out of app/tools/gimpinkoptions-gui.c.
2004-08-04 Simon Budig <simon@gimp.org>
* app/core/gimpbrushgenerated.c: Enhanced the range of the hardness
parameter to make more soft brushes possible. Please note that this
makes existing generated brushes look more soft. But since people
apparently rarely use more than one or two generated brushes and
these get changed frequently I guess it should be OK.
2004-08-04 Michael Natterer <mitch@gimp.org>
Allow URI drops from apps linked against GLib < 2.4.4 to GIMP
linked against GLib >= 2.4.5. Fixes bug #148140.
* app/core/gimp-utils.[ch]: added gimp_check_glib_version().
* app/widgets/gimpselectiondata.c: added runtime check for GLib
versions that encode file:// URIs correctly (>= 2.4.5). For older
(broken) GLibs, leave the code path as is, for newer (fixed) ones,
perform an additional check if the dropped URI is in the (broken)
escaped-UTF-8 format and convert it to local filename encoding.
* app/gui/gui.c: warn the user that non-ASCII filenames can't
be used when linked against GLib 2.4.4.
2004-08-04 Michael Natterer <mitch@gimp.org>
* app/core/gimp.[ch]: changed member "ProcRecord *last_plug_in"
to "PlugInProcDef *last_plug_in". Added function
gimp_set_last_plug_in() and signal Gimp::last-plug-in-changed.
* app/actions/plug-in-commands.c
* app/plug-in/plug-in-run.c: changed accordingly.
* app/actions/plug-in-actions.c: factored out updating of the
"Reshow Last" and "Rerun Last" actions to a private function.
Connect each "plug-in" action group to Gimp::last-plug-in-changed
and update the actions' label and sensitivity in the
callback. Fixes bug #149139.
2004-08-04 Michael Natterer <mitch@gimp.org>
* app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"
2004-08-04 Manish Singh <yosh@gimp.org>
* configure.in: Really really really really fix WINDRES logic.
2004-08-03 DindinX <david@dindinx.org>
* plug-ins/winicon/icodialog.c: ported to GimpPreviewArea. Still needs
work.
2004-08-03 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainergridview.c
(gimp_container_grid_view_item_context): ref/unref the view around
the calls to gimp_container_view_item_selected() and _item_context()
because the former may destroy the view which leads to a crash
when trying the latter. Fixes bug #148955.
2004-08-03 Michael Natterer <mitch@gimp.org>
* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
new function which checks if undo compression is possible:
(1) is the image dirty? Fixes bug #148853.
(2) is redo stack empty?
(3) do both the passed undo object_type and undo_type
match the top undo item?
Consistently name the GType and GimpUndoType passed to undo
functions "object_type" and "undo_type" to avoid confusion.
* app/actions/layers-commands.c
* app/tools/gimpeditselectiontool.c
* app/tools/gimptexttool.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c: use the new utility function
instead of checking the above conditions manually.
2004-08-03 Michael Natterer <mitch@gimp.org>
* app/core/gimpbrushgenerated.c (gimp_brush_generated_load): don't
leak the brush's name if parsing the shape fails.
(gimp_brush_generated_dirty): shut up bogus compiler warnings
about uninitialized variables.
2004-08-03 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/imagemap/imap_preview.c
* plug-ins/imagemap/imap_preview.h: ported to GimpPreviewArea.
2004-08-03 DindinX <david@dindinx.org>
* plug-ins/ifscompose/ifscompose.c: ported to GimpPreviewArea.
2004-08-03 DindinX <david@dindinx.org>
* plug-ins/fp/fp.c: converted to GimpPreviewArea.
2004-08-03 DindinX <david@dindinx.org>
* plug-ins/rcm/rcm_callback.c
* plug-ins/rcm/rcm_dialog.c
* plug-ins/rcm/rcm_misc.c: Ported to GimpPreviewArea.
2004-08-02 Simon Budig <simon@gimp.org>
* app/widgets/gimpbrusheditor.c: Fixed brush spacing for brushes
with >= 2 spikes. Spotted by Joao S. O. Bueno.
Fixes bug #149099.
2004-08-02 DindinX <david@dindinx.org>
* plug-ins/common/whirlpinch.c: ported to GimpPreviewArea.
2004-08-02 DindinX <david@dindinx.org>
* plug-ins/common/video.c: ported to GimpPreviewArea.
2004-08-02 DindinX <david@dindinx.org>
* plug-ins/common/unsharp.c: ported to GimpPreviewArea. Centered the
preview, too.
2004-08-01 DindinX <david@dindinx.org>
* plug-ins/common/tileit.c: ported to GimpPreviewArea.
2004-08-01 DindinX <david@dindinx.org>
* plug-ins/common/sinus.c: ported to GimpPreviewArea.
2004-08-01 Manish Singh <yosh@gimp.org>
* configure.in: Really really really fix WINDRES logic.
2004-08-01 Manish Singh <yosh@gimp.org>
* plug-ins/common/mkgen.pl: update install-% rule to match newer
libtool commands.
* plug-ins/common/Makefile.am: regenerated.
2004-08-01 Manish Singh <yosh@gimp.org>
* configure.in: Really really fix WINDRES logic.
2004-08-01 Manish Singh <yosh@gimp.org>
* configure.in: Really fix WINDRES logic.
2004-08-01 DindinX <david@dindinx.org>
* plug-ins/common/scatter_hsv.c: ported to GimpPreviewArea.
2004-08-01 Hans Breuer <hans@breuer.org>
* app/display/makefile.msc app/widgets/makefile.msc : build
but *dont link* display-enums.obj, widget-enums.obj and
gimpdisplayoptions.obj. They must be in the dll
* app/makefile.msc : build gimp.exe and gimp-console.exe both
using the same gimp-core.dll
* app/gimpcore.def : new file, exports for gimp-core.dll
* app/Makefile.am : added to EXTRA_DIST
* cursors/makefile.msc : new file to create gimp-tool-cursors.h
* cursors/Makefile.am : added to EXTRA_DIST
* **/makefile.msc : updated
* app/main.c app/app_procs.c : moved code to close the console
from the former to the later. It only is to be used if The Gimp
is not build as console app.
* plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same
drawable twice
* plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid
crashing on File/Import
2004-08-01 Simon Budig <simon@gimp.org>
* app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially
reset the number of spikes to 2.
2004-08-01 Simon Budig <simon@gimp.org>
* app/core/gimpbrushgenerated.[ch]: Added optional spikes for
the generated brushes, enabling star shaped generated brushes.
* app/widgets/gimpbrusheditor.[ch]: GUI for this.
* app/core/gimpbrush.c: changed accordingly.
2004-08-01 DindinX <david@dindinx.org>
* plug-ins/common/mapcolor.c
* plug-ins/common/sample_colorize.c: ported to GimpPreviewArea.
* plug-ins/common/newsprint.c: ported to GimpPreviewArea, even though
it should use some pngs instead.
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
* configure.in: modified the checks. hopefully it works on all
platforms this time.
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
* configure.in: move an AM_CONDITIONAL out of an if block
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
* configure.in: added checks for windres. Fixes bug #148443
together with my last commit.
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
* app/Makefile.am: added checks and rules to build and link the
win32 icon resource if the resource compiler windres is found by
configure. First part of a fix for bug #148443.
2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org>
* libgimpwidgets/gimpwidgets.def: added gimp_preview_area_fill
2004-08-01 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/flame/flame.c: ported to GimpPreviewArea.
2004-08-01 Simon Budig <simon@gimp.org>
* app/core/core-enums.h
* app/core/gimpbrushgenerated.[ch]: Implement three different
brush shapes for generated brushes.
* app/core/gimpbrush.c: changed accordingly.
* app/core/core-enums.c: regenerated.
* app/widgets/gimpbrusheditor.[ch]: Add toggles for the shape.
* themes/Default/images/stock-brush-generated-*-16.png: New stock
icons for the brush shapes.
* themes/Default/images/Makefile.am
* libgimpwidgets/gimpstock.[ch]: changed accordingly
untabified the files touched.
2004-08-01 DindinX <david@dindinx.org>
* plug-ins/common/iwarp.c: ported to GimpPreviewArea.
2004-07-31 DindinX <david@dindinx.org>
* plug-ins/common/gqbist.c: ported to GimpPreviewArea.
2004-07-31 DindinX <david@dindinx.org>
* plug-ins/common/fractaltrace.c: ported to GimpPreviewArea.
2004-07-31 DindinX <david@dindinx.org>
* plug-ins/common/exchange.c: ported to GimpPreviewArea.
2004-07-31 DindinX <david@dindinx.org>
* plug-ins/common/emboss.c: ported to GimpPreviewArea.
2004-07-31 DindinX <david@dindinx.org>
* plug-ins/common/diffraction.c: ported to GimpPreviewArea.
2004-07-31 DindinX <david@dindinx.org>
* plug-ins/common/despeckle.c: use even more GimpPreviewArea's
facilities.
* plug-ins/common/destripe.c: ported to GimpPreviewArea.
2004-07-31 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gflare/gflare.c: ported to GimpPreviewArea.
2004-07-31 DindinX <david@dindinx.org>
* plug-ins/common/despeckle.c: ported to GimpPreviewArea.
2004-07-31 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/brush.c
* plug-ins/gimpressionist/orientmap.c
* plug-ins/gimpressionist/paper.c
* plug-ins/gimpressionist/preview.c
* plug-ins/gimpressionist/size.c:
Converted the code from using GtkPreview to GimpPreviewArea.
2004-07-30 Seth Burgess <sjburges@gimp.org>
* plug-ins/common/gauss.c: added some non-interactive modes (if called
from the pdb with RUN_INTERACTIVE).
2004-07-31 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpcolorselect.c: minor cleanup.
2004-07-31 Sven Neumann <sven@gimp.org>
* libgimp/gimppatternmenu.c: ported to GimpPreviewArea.
* libgimp/gimpbrushmenu.c: some small changes for consistency.
2004-07-31 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.[ch]: added new function
gimp_preview_area_fill().
* libgimpwidgets/test-preview-area.c: added a test for new function.
* libgimp/gimpbrushmenu.c: ported to GimpPreviewArea.
2004-07-31 DindinX <david@dindinx.org>
* plug-ins/common/depthmerge.c: use a GimpPreviewArea instead of a
GtkPreview. Some code cleanup, too.
2004-07-31 Sven Neumann <sven@gimp.org>
* libgimp/gimpmenu.c (gimp_menu_make_preview): use a GtkImage and
a GdkPixbuf instead of the deprecated GtkPreview widget.
2004-07-30 DindinX <david@dindinx.org>
* plug-ins/common/curve_bend.c: Use a GimpPreviewArea instead of
GtkPreview.
2004-07-30 Sven Neumann <sven@gimp.org>
Applied a bunch of small changes contributed by Tim Mooney to fix
stack corruption on Tru64 and Aix (bug #129867).
* app/Makefile.am
* plug-ins/script-fu/Makefile.am: changed the dependency order so
that $(REGEXREPL) is linked earlier.
* regexrepl/regex.[ch]: fixed check for __STDC__, merged upstream
fix for re_max_failures value.
2004-07-30 Sven Neumann <sven@gimp.org>
* configure.in: always do the check for perl and use the
substituted perl executable name in the call for gimp-mkenums.
Fixes the build on platforms where perl is not available as
/usr/bin/perl. Closes bug #148813.
* app/widgets/gimpenumstore.c: added missing include.
2004-07-30 DindinX <david@dindinx.org>
* plug-ins/common/channel_mixer.c: GtkPreview->GtkDrawingArea, plus
some minor code cleanups.
2004-07-30 DindinX <david@dindinx.org>
* plug-ins/common/CML_explorer.c: Transformed one GtkPreview to a
GimpPreviewArea and the other to a simple GtkDrawingArea, since this
makes the code simpler.
2004-07-30 Shlomi Fish <shlomif@iglu.org.il>
* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw):
corrected a typo causing mayhem in previews of non-alpha grayscale
images. Fixes bug #148873.
2004-07-30 Sven Neumann <sven@gimp.org>
* plug-ins/common/ccanalyze.c (fillPreview): optimized preview
filling a little bit, removed trailing whitespace.
2004-07-30 DindinX <david@dindinx.org>
* plug-ins/common/ccanalyze.c: converted to use a GimpPreviewArea,
and some small cleanups (g_malloc to g_new, removing tabs)
2004-07-30 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw):
optimized alpha blending.
2004-07-30 Sven Neumann <sven@gimp.org>
Applied a bunch of AIX portability fixes (bug #148813):
* configure.in: when testing for Xmu library, link with -lXt -lX11.
* app/gui/tips-parser.c
* app/gui/user-install-dialog.c
* app/tools/tools-enums.h
* app/widgets/gimpdasheditor.c
* app/widgets/widgets-enums.h
* libgimpthumb/gimpthumb-error.h
* libgimpwidgets/gimpcolorbutton.c
* plug-ins/common/edge.c: removed trailing commas from enums.
* plug-ins/common/snoise.c: renamed defines to avoid collision
with system headers.
* plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.
* app/paint-funcs/paint-funcs-generic.h
* app/paint-funcs/paint-funcs.c: use integers for bit fields.
2004-07-30 Sven Neumann <sven@gimp.org>
* plug-ins/common/bumpmap.c: removed preview code that isn't used
any longer.
2004-07-30 DindinX <david@dindinx.org>
* plug-ins/common/bumpmap.c: use GimpPreviewArea instead of
GtkPreview (which leads to much simpler code)
2004-07-29 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppreviewarea.c: only invalidate the buffer
on size_allocate; allocate a new one on the next call to
gimp_preview_area_draw(). Fixed buffer offset in expose method.
* libgimpwidgets/Makefile.am
* libgimpwidgets/test-preview-area.c: more a benchmark than a
test; quite similar to testrgb from the GTK+ source tree.
2004-07-29 DindinX <david@dindinx.org>
* plug-ins/FractalExplorer/Dialogs.c: converted all GtkPreview
widgets to GimpPreviewArea.
2004-07-29 Michael Natterer <mitch@gimp.org>
* libgimpmodule/gimpmoduledb.c: converted tabs to spaces, removed
unused #if 0'ed prototype and unused #includes, minor cleanups.
2004-07-29 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/*.[ch]: normalized the names of the fields
of gimpressionist_vals_t.
2004-07-29 Sven Neumann <sven@gimp.org>
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpwidgets.def
* libgimpwidgets/gimpwidgets.h
* libgimpwidgets/gimpwidgetstypes.h
* libgimpwidgets/gimppreviewarea.[ch]: added GimpPreviewArea, a
replacement for GtkPreview, loosely based on patches from Geert
Jordaens and David Odin. Fixes bug #144759.
* plug-ins/common/sharpen.c: use the new widget instead of a
GtkPreview; saves about 100 lines of rather complex code :)
2004-07-29 Michael Natterer <mitch@gimp.org>
* etc/controllerrc: changed default configuration of the keyboard
controller: scroll the display one step on cursor_key, scroll by
one page on <shift>+cursor_key and scroll to top/bottom/left/right
on <control>+cursor_key. Fixes bug #53988.
Moved the old opacity-modifying actions to <alt>+cursor_key.
2004-07-29 Michael Natterer <mitch@gimp.org>
Replaced the concept of having a boolean indicating if an undo
step dirties the image by a bitfield indicating which parts
of the image are dirtied:
* app/core/core-enums.[ch]: reordered two values in enum
GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask.
The values of GimpDirtyMask are still questionable and will
probably change...
* app/core/gimpimage.[ch]: removed signal "undo_start" and added
a GimpDirtyMask parameter to the "dirty" and "clean" signals.
* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced
"gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass
it to gimp_image_dirty().
(gimp_image_undo_group_start): added *ugly* code which tries to
figure GimpDirtyMask from the group's GimpUndoType and store it in
the GimpUndoGroup. Call gimp_image_dirty() instead of the removed
gimp_image_undo_start(). This means the undo group now dirties the
image just like one of its undo steps, but that's no problem since
undoing cleans it in the same way.
* app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g
(gimp_undo_pop): emit clean/dirty signals *before* performing the
actual undo step so listeners can detach from the image before it
is changed by undo.
* app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a
GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push().
* app/core/gimpimagemap.[ch]: removed "gboolean interactive"
because it makes no sense to use GimpImageMap noninteractively.
Don't freeze()/thaw() undo while the image_map is active which
fixes many ways of trashing the image's undo state but probably
introduces new ways of doing evil things.
* app/display/gimpdisplay-foreach.c
* app/display/gimpdisplayshell-handlers.c: changed according
to the GimpImage::clean()/dirty() signal changes. Small fixes
in the quit dialog's dirty image container.
* app/tools/gimptoolcontrol.[ch]: added member and API to
set/get the dirty_mask.
* app/tools/gimpcroptool.c
* app/tools/gimpimagemaptool.c
* app/tools/gimpiscissorstool.c
* app/tools/gimptexttool.c
* app/tools/gimptransformtool.c: whenever setting "preserve" to
FALSE, also set a "dirty_mask" which specifies on which image
changes the tool wants to be canceled.
* app/tools/tool_manager.c: removed "undo_start" connection and
connect to both "dirty" *and* "clean" to check if the active_tool
needs to be canceled. Cancel the tool only if the dirty_mask
passed in the signal has common bits with the tool's dirty_mask.
Fixes bug #109561 and probably opens some new ones...
2004-07-29 Michael Schumacher <schumaml@cvs.gnome.org>
* libgimp/gimp.def
* libgimp/gimpui.def: added some missing symbols
2004-07-29 Sven Neumann <sven@gimp.org>
* libgimpbase/gimpbase.def: added new symbols.
2004-07-29 Michael Natterer <mitch@gimp.org>
Added support for motion event history as provided by some input
device drivers. If you have a tablet driver supporting this,
please try and report back.
* app/display/gimpdisplayshell.h (struct GimpDisplayShell): added
member "guint32 last_motion_time".
* app/display/gimpdisplayshell-callbacks.c
(gimp_display_shell_tool_events): remember the last_motion_time on
button_press() and after motion() and ask the current device for
its motion history; in motion(), if the active_tool asks for exact
motions, check if the input device recorded a motion history and
process the history instead of the motion event.
(gimp_display_shell_get_time_coords): new utility function which
gets GimpCoords from a GdkTimeCoord struct as used by the motion
history.
2004-07-29 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/repaint.c: converted a multiple if into
a nested one.
2004-07-29 Sven Neumann <sven@gimp.org>
* app/core/core-enums.h: removed enums GimpImageType and
GimpImageBaseType ...
* libgimpbase/gimpbaseenums.h: ... and added them here. Also moved
all enums from gimpbasetypes.h to this new file.
* libgimpbase/Makefile.am
* tools/pdbgen/Makefile.am: changed accordingly.
* app/core/core-enums.c
* libgimp/gimpenums.h
* libgimpbase/gimpbaseenums.c
* tools/pdbgen/enums.pl: regenerated.
* libgimpbase/gimpparasite.c
* libgimpbase/gimpprotocol.c
* libgimp/gimp.c: include <glib-object.h>
* libgimpbase/gimpbasetypes.[ch]: added API to set and get a
translation domain on a GType. This is used for translatable enum
values.
* libgimpbase/gimputils.[ch]: added API to retrieve the translated
name for an enum value.
* app/widgets/gimpenumstore.c
* app/widgets/gimpenumwidgets.c: use the new API in libgimpbase.
2004-07-29 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawable.c: fixed gtk-doc comments.
2004-07-29 Dave Neary <bolsh@gimp.org>
* app/core/gimpdrawable-transform.c: Stop signed ints overflowing
while getting the mean by replacing (a + b) / 2 with a / 2 + b / 2.
Fixes bug #128594 for drawables less than 32K wide.
2004-07-29 Michael Natterer <mitch@gimp.org>
* app/gui/preferences-dialog.c: renamed "Cleared saved foobar now"
buttons to "Reset saves foobar to default values". Fixes bug #5673.
Added mnemonics for all the configure/save/reset buttons.
2004-07-29 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-scripts.c (script_fu_free_script):
applied patch by Kevin Cozens that moves a g_free() to the right
place (bug #148729).
2004-07-28 Michael Natterer <mitch@gimp.org>
* app/actions/actions.c (action_groups): register the
GIMP_STOCK_VISIBLE icon with the "view" action group.
2004-07-28 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/brush.c: removed a redundant parameter
from one of the internal functions.
* plug-ins/gimpressionist/utils.c: Made sure that resources that
are selected by the presets will position their list views
accordingly.
2004-07-28 Sven Neumann <sven@gimp.org>
* autogen.sh: if the check for libtoolize fails, try glibtoolize.
2004-07-28 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/presets.c: created a base function for
two functions with duplicate code.
2004-07-28 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_default_dialog.c: no need to include
"libgimp/stdplugins-intl.h" here.
2004-07-28 Michael Natterer <mitch@gimp.org>
* app/gui/preferences-dialog.c (prefs_dialog_new): reordered
buttons in the Interface -> Keyboard Shortcuts section to be
consistent with other sections which provide configure/save/clear
buttons.
2004-07-28 Michael Natterer <mitch@gimp.org>
* app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init)
* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_init):
don't call gimp_tool_control_set_preserve (tool->control, FALSE)
because these tools don't cache any image state and don't care
about the image changing under their feet.
2004-07-28 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell.c (gimp_display_shell_reconnect):
emit "reconnect" *before* emitting scale and scroll events so
listeners (the navigation view) can switch to the new image at the
right time.
2004-07-28 Sven Neumann <sven@gimp.org>
Applied a patch from Brion Vibber that makes the TWAIN plug-in
available on Mac OS X (bug #147962):
* configure.in
* plug-ins/Makefile.am: check for Mac OS X twain support.
* plug-ins/twain/Makefile.am
* plug-ins/twain/tw_local.h
* plug-ins/twain/tw_mac.c
* plug-ins/twain/tw_platform.h
* plug-ins/twain/tw_win.c: new files with platform specific code.
* plug-ins/twain/README
* plug-ins/twain/tw_dump.[ch]
* plug-ins/twain/tw_func.[ch]
* plug-ins/twain/tw_util.[ch]
* plug-ins/twain/twain.c: changed accordingly.
* plug-ins/twain/gimp-twain.png: twain application icon used by
the Mac port.
* plug-ins/twain/tw_sess.c: removed, doesn't seem to be used.
2004-07-28 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/image.pdb (image_is_dirty): fix typo in
parameter description.
* app/pdb/image_cmds.c
* libgimp/gimpimage_pdb.c: regenerated.
2004-07-28 DindinX <david.odin@cpe.fr>
* plug-ins/common/unsharp.c: Added a toggle button to enable/disable
preview updating. Should fix #144972.
2004-07-28 DindinX <david.odin@cpe.fr>
* plug-ins/common/shift.c
* plug-ins/common/sinus.c
* plug-ins/common/snoise.c
* plug-ins/common/spheredesigner.c: added missing calls to
g_rand_free (), remove tabs while I was at it.
* plug-ins/common/smooth_palette.c: minor cleanup
* plug-ins/common/spread.c: removed tabs.
2004-07-28 Michael Natterer <mitch@gimp.org>
* app/core/core-enums.h: added still unused flags type
GimpDirtyMask.
* app/base/Makefile.am
* app/core/Makefile.am
* app/display/Makefile.am
* app/paint/Makefile.am
* app/text/Makefile.am
* app/tools/Makefile.am
* app/widgets/Makefile.am
* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
support GTypeFlags and to make the value arrays private to the
get_type() functions.
* app/base/base-enums.c
* app/core/core-enums.c
* app/display/display-enums.c
* app/paint/paint-enums.c
* app/text/text-enums.c
* app/tools/tools-enums.c
* app/widgets/widgets-enums.c: regenerated.
2004-07-28 Michael Natterer <mitch@gimp.org>
* app/paint/gimpclone.c: converted tabs to spaces.
2004-07-28 DindinX <david.odin@cpe.fr>
* plug-ins/common/spread.c: fix a smallish memory leak.
2004-07-28 Sven Neumann <sven@gimp.org>
* tools/gimp-mkenums: synced with glib-mkenums (execept for the
newly added template feature).
2004-07-28 Michael Natterer <mitch@gimp.org>
* libgimp/gimpbrushselect.c
* libgimp/gimpfontselect.c
* libgimp/gimpgradientselect.c
* libgimp/gimppalettemenu.c
* libgimp/gimppaletteselect.c
* libgimp/gimppatternselect.c (gimp_*_select_destroy): don't
leak the selected object's name and its data (brush mask etc).
* libgimp/gimpfontmenu.c: moved the icon to the left side of the
button.
* libgimp/gimppalettemenu.c: ditto. Added "Since: GIMP 2.2" to
API docs.
2004-07-28 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpactiongroup.c
(gimp_action_group_set_action_label): forgot to strip mnemonics
here.
2004-07-28 Michael Natterer <mitch@gimp.org>
Enabled disabling all menu mnemonics. Addresses bug #120034:
* app/config/gimpguiconfig.[ch]
* app/config/gimprc-blurbs.h: added boolean RESTART property
"menu-menonics".
* app/gui/preferences-dialog.c: added a GUI for it.
* app/widgets/gimpactiongroup.[ch]: added boolean CONSTRUCT_ONLY
property "mnemonics".
(gimp_action_group_add_*_actions): call gimp_strip_uline() on
the actions' labels if mnemonics is FALSE.
* app/widgets/gimpactionfactory.[ch]
* app/actions/actions.c: pass gui_config->menu_menmonics to
all action groups.
2004-07-27 Sven Neumann <sven@gimp.org>
* menus/image-menu.xml.in: commented out "Context" menu now that
we have a shortcut editor.
2004-07-27 Sven Neumann <sven@gimp.org>
* app/core/gimpgradient-load.c: don't leak empty SVG gradients.
2004-07-27 Sven Neumann <sven@gimp.org>
* app/actions/image-commands.c: include "libgimpbase/gimpbase.h",
not an individual header out of libgimpbase.
2004-07-27 Sven Neumann <sven@gimp.org>
* libgimpbase/Makefile.am
* libgimpbase/gimpbase.h
* libgimpbase/gimpbase.def
* libgimpbase/gimpmemsize.[ch]: added new files with memsize
related functions (moved here from gimputil.c) and
GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).
* libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.
* libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
app/config/gimpconfig-types.[ch]).
* libgimpbase/gimpbase-private.c
* libgimp/gimptile.c
* libgimp/gimpunitcache.c
* plug-ins/help/domain.c
* app/xcf/xcf-read.c: need to include glib-object.h.
* plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.
* app/config/gimpconfig-types.[ch]: removed code that lives in
libgimpbase now.
* app/config/gimpconfig-deserialize.c: changed accordingly.
* app/config/gimpbaseconfig.c
* app/config/gimpdisplayconfig.c
* app/core/gimpcontext.c
* app/gui/grid-dialog.c
* app/tools/gimpcolortool.c
* app/widgets/gimpaction.c
* app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
any longer.
004-07-27 Michael Natterer <mitch@gimp.org>
* libgimp/Makefile.am
* libgimp/gimp.h
* libgimp/gimpui.h
* libgimp/gimppalettemenu.[ch]
* libgimp/gimppaletteselect.[ch]: added palette select wrapper and
widget (straight copy & string replace of the font select stuff).
Fixes bug #136130.
* plug-ins/script-fu/script-fu-enums.h
* plug-ins/script-fu/script-fu-scripts.c
* plug-ins/script-fu/siod-wrapper.c: added SF_PALETTE so it can
be used in scripts.
* plug-ins/script-fu/scripts/test-sphere.scm: added a palette
parameter to the test script.
2004-07-27 Michael Natterer <mitch@gimp.org>
* app/core/gimpimage.c (gimp_image_finalize): remove the image
from the image hash table and set its "gimp" pointer to NULL
*after* all layers, channels, vectors and the selection are
finalized; otherwise these items have no chance of removing
themselves from the item hash table (because image->gimp is
already NULL). Spotted by pgimeno and nomis.
(should be backported after it got some testing)
2004-07-27 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change.
2004-07-27 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make
sure we always set a non-null URI.
2004-07-27 Sven Neumann <sven@gimp.org>
* app/widgets/gimphelp-ids.h removed unused help IDs
GIMP_HELP_FILE_OPEN_XCF and GIMP_HELP_FILE_SAVE_XCF. The help IDs
for these entries are generated from the procedure names.
2004-07-27 Sven Neumann <sven@gimp.org>
* app/widgets/gimphelp.c (gimp_help): print the help-id and
help-domain to stdout if gimp was started with the --verbose
command-line option.
2004-07-27 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
show extensions in the filters menu. Is this a good idea at all?
2004-07-27 Sven Neumann <sven@gimp.org>
* libgimp/gimpbrushmenu.c
* libgimp/gimppatternmenu.c: attempt to make the brush and pattern
selectors look less like buttons (supposed to fix bug #147777).
2004-07-27 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpcolorhexentry.c (gimp_color_hex_entry_events):
also accept the short hexadecimal notation (3 hex digits).
2004-07-26 Sven Neumann <sven@gimp.org>
* libgimpwidgets/Makefile.am (libgimpwidgetsinclude_HEADERS):
added new files.
2004-07-26 Sven Neumann <sven@gimp.org>
* app/widgets/Makefile.am
* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimptoolview.c
* app/widgets/widgets-types.h: changed accordingly.
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpwidgets.def
* libgimpwidgets/gimpwidgets.h
* libgimpwidgets/gimpwidgetsmarshal.list
* libgimpwidgets/gimpwidgetstypes.h
* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
renderer moved here from app/widgets.
* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
new toggle cell renderer.
2004-07-26 Michael Natterer <mitch@gimp.org>
* app/pdb/procedural_db.[ch] (procedural_db_free_data): new
function which clears the whole list of data set by plug-ins.
(procedural_db_free): use it.
* app/actions/plug-in-actions.c
* app/actions/plug-in-commands.[ch]: added action, callback and
confirmation dialog for "Reset all filters to default values".
Somehow addresses bug #81015.
* app/widgets/gimphelp-ids.h: added a help ID for the new action.
* menus/image-menu.xml.in: added it to the "Filters" submenu.
2004-07-26 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpcellrenderercolor.c
(gimp_cell_renderer_color_get_size): fine-tuning.
2004-07-26 Michael Natterer <mitch@gimp.org>
* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.
* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
to GimpParamSpecRGB.
* app/config/gimpconfig-deserialize.c
* app/config/gimpconfig-dump.c
* app/config/gimpconfig-serialize.c
* app/config/gimpscanner.c
* app/core/gimp-utils.c
* app/core/gimpcontext.c
* app/core/gimpgrid.c
* app/display/gimpdisplayoptions.c
* app/text/gimptext.c
* app/tools/gimpcolortool.c
* app/widgets/gimpaction.c
* app/widgets/gimpcolorbar.c
* app/widgets/gimppropwidgets.c: changed accordingly.
2004-07-26 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: added a de-allocation to the PPM's
allocated by the size map dialog.
2004-07-26 Sven Neumann <sven@gimp.org>
* app/core/gimpgradient-load.c: load all linear gradients from an
SVG file, not only the first one.
2004-07-26 Michael Natterer <mitch@gimp.org>
* app/core/gimpdatafactory.h: added "gboolean writable" to the
GimpDataFactoryLoaderEntry struct. Return a GList* instead of
GimpData* from GimpDataLoadFunc so it's possible to load more than
one data object from one file.
* app/core/gimpdatafactory.c (gimp_data_factory_load_data):
changed accordingly: add all items of the returned lists to the
data factory. Make the data object writable only if it's in the
writable path *and* its loader entry says it's a writable format
*and* the returned list contains exactly one element.
* app/core/gimp.c (gimp_real_initialize): declare all loader
entries as writable where we have code to read and write exactly
one object per file; all others are not writable.
* app/core/gimpbrush.[ch]
* app/core/gimpbrushgenerated.[ch]
* app/core/gimpbrushpipe.[ch]
* app/core/gimpgradient-load.[ch]
* app/core/gimppalette.[ch]
* app/core/gimppattern.[ch] (all load functions): return a list
containing the loaded object instead of the object itself.
2004-07-26 Sven Neumann <sven@gimp.org>
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpwidgets.def
* libgimpwidgets/gimpwidgets.h
* libgimpwidgets/gimpwidgetstypes.h
* libgimpwidgets/gimpcellrenderercolor.[ch]: added a GimpRGB cell
renderer.
* libgimpwidgets/gimpcolorarea.[ch]: exported the function that
renders the color to a buffer for internal use in libgimpwidgets.
* libgimpwidgets/gimpcolorhexentry.c: use the new cell renderer
for the completion popup.
2004-07-26 Sven Neumann <sven@gimp.org>
* libgimpcolor/gimpcolor.def
* libgimpwidgets/gimpwidgets.def: added new symbols.
2004-07-26 Sven Neumann <sven@gimp.org>
* libgimpcolor/gimprgb.[ch]: register GimpRGB as a boxed type.
* libgimpcolor/gimpadaptivesupersample.c
* libgimpcolor/gimpcolorspace.c
* libgimpcolor/gimprgb-parse.c
* libgimp/gimp.h: include <glib-object.h> instead of <glib.h>.
2004-07-26 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: placed all the orientation map-related
public functions in orientmap.h. Now we're freeing the PPM's that it
is allocating by a call to orientation_map_free_resources().
2004-07-26 Michael Natterer <mitch@gimp.org>
* app/core/core-types.h: removed unused typedef
GimpDataObjectLoaderFunc.
2004-07-26 Sven Neumann <sven@gimp.org>
* libgimpcolor/gimprgb-parse.c
* libgimpcolor/gimprgb.h: added new function gimp_rgb_list_names()
that gives access to the list of SVG color keywords.
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpwidgets.h
* libgimpwidgets/gimpwidgetstypes.h
* libgimpwidgets/gimpcolorhexentry.[ch]: added new widget that
allows to enter colors in hex notation or by using color names.
* libgimpwidgets/gimpcolorscales.c: use a GimpColorHexEntry.
2004-07-26 Michael Natterer <mitch@gimp.org>
* app/tools/gimpeditselectiontool.[ch]: renamed init_edit_selection()
to gimp_edit_selection_tool_start(). Removed enum EditType.
* app/tools/tools-enums.h: added enum GimpTranslateMode instead.
* app/tools/gimpmovetool.c: changed accordingly.
* app/tools/gimpselectiontool.[ch]: added protected utility
function gimp_selection_tool_start_edit().
* app/tools/gimpfreeselecttool.c
* app/tools/gimpfuzzyselecttool.c
* app/tools/gimprectselecttool.c: use the new function instead of
duplicating the same code three times, don't include
"gimpeditselectiontool.h".
* app/tools/gimpiscissorstool.c: don't include
"gimpeditselectiontool.h".
2004-07-26 Michael Natterer <mitch@gimp.org>
* app/tools/gimpeditselectiontool.c: don't freeze()/thaw() the
image's undo to prevent live-movement from ending up on the undo
stack. Instead, just stop pushing undo steps after the initial
movement. Simplifies edit_select's undo code quite a bit and fixes
bug #148458.
2004-07-26 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpcolorscales.c (gimp_color_scales_hex_events):
accept SVG color names in the hex entry. Not very intuitive but
probably a nice experts feature and it can be improved later.
2004-07-26 Michael Natterer <mitch@gimp.org>
* app/main.c (main): use #ifdef GIMP_UNSTABLE instead of looking
at GIMP_MINOR_VERSION.
* app/app_procs.c: don't #include "tools/gimp-tools.h".
2004-07-26 Sven Neumann <sven@gimp.org>
* plug-ins/bmp/bmp.h
* plug-ins/bmp/bmpread.c: applied a patch by Brion Vibber that
fixes extra data overflow, nonstandard 16bpp field arrangement
and unrecognized compression (bug #143682).
2004-07-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/decompose.c: clamp results of LAB decomposition
so that out-of-gamut conversions do not overflow and get badly
distorted. Fixes bug #147603. Note that it would probably be a
good idea to do similar things for other conversion types.
2004-07-25 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: converted checks for initialization of
ppm's done by checking the "col" buffer, to macro calls.
2004-07-25 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: fixed bug #148088: ("Gimpressioinst
crashes if given malicious presets with out of range values, in
the radio buttons group numeric values: "placetype", "orienttype",
etc. ").
This was done by adding clamps to the relevant values in the preset.
2004-07-25 Raphaël Quinet <quinet@gamers.org>
* INSTALL: Minor fixes and improvements. Suggest using a
different prefix and setting PKG_CONFIG_LIBDIR if old versions of
GTK+ libs are found and cannot be removed without breaking other
packages.
2004-07-23 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: created a header "orientation.h"
for the Orientation tab specific declarations.
2004-07-23 Sven Neumann <sven@gimp.org>
* libgimp/gimppixbuf.c (gimp_pixbuf_from_data): added missing code
for grayscale previews.
2004-07-23 Sven Neumann <sven@gimp.org>
* app/core/gimpgradient-load.c (svg_parser_end_element): fixed
handling of the last gradient segment and did some code cleanup.
2004-07-23 Sven Neumann <sven@gimp.org>
* app/core/gimpgradient-load.c (gimp_gradient_load_svg): improved
error message.
(svg_parser_end_element): don't crash on empty gradient definitions.
2004-07-23 Sven Neumann <sven@gimp.org>
* libgimpcolor/test-color-parser.c: added more test samples.
* libgimpcolor/gimprgb-parse.c: fixed a bug that I found with the
new tests.
* app/core/gimpgradient-load.c: changed SVG parser to handle
gradients that are defined more deeply in the SVG hierarchy. Added
a simplistic CSS style parser to deal with gradient definitions
that use CSS to define the gradient stop properties (closes bug
#148127).
2004-07-23 Sven Neumann <sven@gimp.org>
* app/core/gimpdatafactory.c: some newlines to improve error
messages.
* app/core/gimpgradient-load.c (gimp_gradient_load_svg): fixed
error handling.
2004-07-23 Sven Neumann <sven@gimp.org>
* libgimpcolor/Makefile.am
* libgimpcolor/test-color-parser.c: added a simple unit test
framework for the color parser.
* libgimpcolor/gimprgb-parse.c: fixed parsing of rgba() values.
* libgimpmath/test-md5.c: minor cleanup.
2004-07-23 Sven Neumann <sven@gimp.org>
* libgimpcolor/gimprgb-parse.c (gimp_rgba_parse_css): added support
for the "transparent" color name.
2004-07-22 Sven Neumann <sven@gimp.org>
* libgimpcolor/gimprgb-parse.c
* libgimpcolor/gimprgb.h: improved the CSS color parser code,
added new function gimp_rgba_parse_css(), added support for HSL
color values.
2004-07-22 Sven Neumann <sven@gimp.org>
* libgimpcolor/gimprgb-parse.c
* libgimpcolor/gimprgb.h: use a signed integer to pass the string
length to the new parser functions. The API explicitely asks for
-1 to be passed...
* app/core/gimp.c
* app/core/gimpgradient-load.[ch]
* app/core/gimpgradient.h: added preliminary support for loading
simple SVG gradients (see bug #148127). Be careful with this new
feature; editing the loaded gradient will cause the SVG file to be
overwritten! Work in progress...
2004-07-22 Sven Neumann <sven@gimp.org>
* app/core/Makefile.am
* app/core/gimpgradient-load.[ch]
* app/core/gimpgradient-save.[ch]
* app/core/gimpgradient.[ch]: moved gradient file handling out of
gimpgradient.c to new files.
* app/core/gimp.c
* app/actions/gradients-commands.c: changed accordingly.
* libgimpcolor/gimpcolor.def: added gimp_rgb_parse_name.
2004-07-22 Michael Natterer <mitch@gimp.org>
* data/misc/gimp.desktop.in.in (MimeType): image/g -> image/g3fax.
2004-07-22 Sven Neumann <sven@gimp.org>
* app/widgets/gimpactionview.c: rephrased the text for the dialog
that appears if a new shortcut collides with an existing one.
* libgimpcolor/gimprgb.[ch]: added new function gimp_rgb_parse_name()
which accepts RGB colors in hexadecimal notation or as SVG color
keywords.
2004-07-22 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell.c (gimp_display_shell_resume):
s/pause/resume/ in the API docs.
2004-07-22 Michael Natterer <mitch@gimp.org>
* tools/gimp-remote.c (main): correctly convert relative paths to
URIs. Append the resulting URI only if it's not NULL.
2004-07-22 Michael Natterer <mitch@gimp.org>
* app/widgets/gimptoolbox.c (toolbox_create_tools): connect to
"accel-changed" of the accel_group using connect_object(), not
just connect() so we don't crash when it's emitted after the
toolbox is destroyed.
2004-07-21 Ray Strode <rstrode@redhat.com>
* gimp/data/misc/gimp.desktop.in.in: Add MimeType line to desktop
file for new MIME system.
2004-07-21 Sven Neumann <sven@gimp.org>
* plug-ins/common/gif.c: declared global const variable as static.
Fixes compiler warnings seen with gcc 3.4.1 (don't ask me why).
2004-07-21 Michael Natterer <mitch@gimp.org>
* app/widgets/gimptemplateeditor.c
* plug-ins/common/gif.c
* plug-ins/common/jpeg.c: set GTK_SHADOW_IN on scrolled windows of
text views. Fixes bug #148025.
2004-07-21 Michael Natterer <mitch@gimp.org>
Enabled the various "Clear saved foobar now" buttons in prefs:
* app/gui/session.[ch]
* app/menus/menus.[ch]
* app/widgets/gimpdevices.[ch]: implemented the _clear()
functions: unlink() the rc file and set an internal flag that it
has been deleted. Added "gboolean always_save" parameter to the
_save() functions and don't save anything if it is FALSE and the
internal deletion flag has been set.
* app/gui/gui.c
* app/widgets/gimpdevicestatus.c: changed accordingly.
* app/gui/preferences-dialog.c: added callbacks for all "Save now"
and "Clear now" buttons and show error messages if clearing fails.
Inform the user that she has to restart GIMP to see the effect of
the clearing.
2004-07-21 Michael Natterer <mitch@gimp.org>
* app/core/gimpmarshal.list
* app/widgets/gimpcellrendereraccel.[ch]: added "gboolean delete"
parameter to the GimpCellRendererAccel::accel_edited() signal.
* app/widgets/gimpactionview.c: distinguish between deletion of an
accelerator and the user entering an invalid accelerator.
2004-07-21 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: normalized the identifiers in
placement.c.
2004-07-21 Michael Natterer <mitch@gimp.org>
* app/actions/context-actions.c: changed names of actions which
select brushes, patterns etc. from e.g. "context-brush-first" to
"context-brush-select-first".
* menus/image-menu.xml.in: changed accordingly.
2004-07-21 Michael Natterer <mitch@gimp.org>
* app/gui/preferences-dialog.c: remember the keyboard shortcut
dialog and show it only once.
* app/widgets/gimpactionview.c
* app/widgets/gimpcellrendereraccel.c: minor cleanups.
Seems to work pretty well now and thus fixes bug #142922.
2004-07-21 Michael Natterer <mitch@gimp.org>
* app/core/gimpmarshal.list
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpcellrendereraccel.[ch]: new cell renderer
which displays an accelerator and allows to edit it (ripped
out of libegg and modified).
* app/widgets/gimpactionview.c: use the new renderer and connect
to its "accel-edited" signal (its callback is one huge mess that
needs to be cleaned up). Added ugly hack to work around GTK+ API
limitation that seems to prevent implementing a shortcut editor in
a sane way.
* app/actions/file-actions.c
* app/actions/image-actions.c
* app/actions/tools-actions.c: added ugly hacks here, too.
* app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut
editor by Close.
2004-07-20 Sven Neumann <sven@gimp.org>
* configure.in (ALL_LINGUAS): added back "pa" for Punjabi now that
the missing po files have been added (tips/pa.po is still missing
though).
2004-07-20 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpactionfactory.[ch]
* app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id"
properties to GtkActionGroup and allow to register them in the
GimpActionFactory.
* app/actions/actions.c: register user visible labels and icons
with all action groups.
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpactionview.[ch]: new widget which shows a
treeview of action groups and their actions & shortcuts.
* app/widgets/gimpaction.[ch]: added gimp_action_name_compare()
utility function.
* app/widgets/gimpwidgets-utils.[ch]: added
gimp_get_accel_string() utility function.
* app/widgets/gimpcontrollers.[ch]: added
gimp_controllers_get_ui_manager() which will be used for setting
up the controller mapping dialog.
* app/gui/preferences-dialog.c: added a "Configure Keyboard
Shortcuts" button which pops up a GimpActionView. Work in
progress...
2004-07-20 Michael Natterer <mitch@gimp.org>
* app/actions/image-actions.c: make sure that the "image-new" and
"image-new-from-image" actions always have the same shortcut.
2004-07-20 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/Lighting/lighting_main.c
* plug-ins/Lighting/lighting_main.h
* plug-ins/Lighting/lighting_preview.c
* plug-ins/Lighting/lighting_preview.h
* plug-ins/Lighting/lighting_shade.c
* plug-ins/Lighting/lighting_ui.c: completely reworked UI for
lighting page. Now supports up to 6 lights (more is trivial).
Added ability to temporarily isolate selected light. Added
light intensity controls. Can interactively position each light
(does not quite work yet for directional lights).
2004-07-20 Michael Natterer <mitch@gimp.org>
* app/actions/tools-actions.c: added an icon to the
"tools-visibility" action.
2004-07-20 Sven Neumann <sven@gimp.org>
* app/composite/gimp-composite.c (gimp_composite_init): now that
the output depends on --verbose, enable it for stable releases also.
2004-07-20 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/presets.c: fixed the incorrect strings
for input and output of the preset's fields. (a relic of an
irresponsible search-and-replace script).
* plug-ins/gimpressionist/: normalized the identifiers of
orientmap.c.
2004-07-20 Helvetix Victorinox <helvetix@gimp.org>
* app/composite/Makefile.am (regenerate): Updated make-installer.py
command line to take advantage of the new compile time method of
determining which instruction set to compile.
* app/composite/gimp-composite.c (gimp_composite_init): Print the
list of active instruction sets if the --verbose command line
switch is ON (via be_verbose)
* app/composite/gimp-composite-x86.h: Factored code from the mmx,
and sse implementations.
* app/composite/make-installer.py: Raised the number of test
iterations from 1 to 10.
* app/composite/gimp-composite-3dnow.[ch]
* app/composite/gimp-composite-3dnow-test.c
* app/composite/gimp-composite-3dnow-installer.c
* app/composite/gimp-composite-altivec.[ch]
* app/composite/gimp-composite-altivec-test.c
* app/composite/gimp-composite-altivec-installer.c
* app/composite/gimp-composite-mmx.[ch]
* app/composite/gimp-composite-altivec-test.c
* app/composite/gimp-composite-altivec-installer.c
* app/composite/gimp-composite-sse.[ch]
* app/composite/gimp-composite-sse-test.c
* app/composite/gimp-composite-sse-installer.c
* app/composite/gimp-composite-sse2.[ch]
* app/composite/gimp-composite-sse2-test.c
* app/composite/gimp-composite-sse2-installer.c
* app/composite/gimp-composite-vis.[ch]
* app/composite/gimp-composite-vis-test.c:
Regenerated sources via make-installer.py
2004-07-20 Sven Neumann <sven@gimp.org>
* app/app_procs.c
* app/base/base.[ch]
* app/composite/gimp-composite.[ch]: pass "be_verbose" to the base
and composite subsystems.
2004-07-20 Sven Neumann <sven@gimp.org>
* autogen.sh: added some empty lines to improve readability of the
output in case of problems.
* configure.in: bumped version number to 2.1.3.
2004-07-19 Helvetix Victorinox <helvetix@gimp.org>
* app/composite/gimp-composite-mmx.c
(xxxgimp_composite_dodge_rgba8_rgba8_rgba8_mmx)
* app/composite/gimp-composite-mmx.c
(xxxgimp_composite_divide_rgba8_rgba8_rgba8_mmx)
* app/composite/gimp-composite-mmx.c
(gimp_composite_difference_rgba8_rgba8_rgba8_mmx)
* app/composite/gimp-composite-mmx.c
(gimp_composite_darken_rgba8_rgba8_rgba8_mmx): More clobber
register corrections.
2004-07-20 Sven Neumann <sven@gimp.org>
* Made 2.1.2 release.
2004-07-20 Sven Neumann <sven@gimp.org>
* plug-ins/winicon/icoload.c
* plug-ins/winicon/icosave.c: added explicit casts to please the
compiler.
2004-07-20 Sven Neumann <sven@gimp.org>
* plug-ins/gimpressionist/Makefile.am (gimpressionist_sources):
added paper.h.
* plug-ins/MapObject/Makefile.am (MapObject_SOURCES): added back
arcball.h.
* plug-ins/MapObject/mapobject_main.c
* plug-ins/MapObject/mapobject_preview.c: no need to include
arcball.h here.
* plug-ins/gfig/Makefile.am (SUBDIRS): added back gfig-examples
* plug-ins/gfig/gfig-examples/Makefile.am: cleanup.
2004-07-20 Sven Neumann <sven@gimp.org>
* plug-ins/Lighting/lighting_ui.c: fixed some GUI issues:
left-align labels, use stock buttons, added line-breaks to make
the code fit into 80 columns.
2004-07-19 Sven Neumann <sven@gimp.org>
* plug-ins/Lighting/lighting_ui.c: fixed a couple of issues with
the new code: don't include individual glib headers, never ever
use sprintf(), mark user-visible strings for translations, use
default messages, removed trailing whitespace.
2004-07-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/Lighting/lighting_ui.c: added ability to save and load
presets for lights.
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/orientation.c: normalized some variables
in the module and fixed some indentation.
2004-07-19 Helvetix Victorinox <helvetix@gimp.org>
* app/composite/gimp-composite-mmx.c
(gimp_composite_addition_rgba8_rgba8_rgba8_mmx)
* app/composite/gimp-composite-mmx.c
(gimp_composite_burn_rgba8_rgba8_rgba8_mmx)
* app/composite/gimp-composite-x86.h: Correction of clobbered
register lists, as additional progress against bug #147013.
2004-07-19 Michael Natterer <mitch@gimp.org>
* app/core/gimpmarshal.list: removed unused VOID:UINT,STRING.
2004-07-19 Michael Natterer <mitch@gimp.org>
* app/gui/file-open-location-dialog.c
(file_open_location_dialog_show): added the "web" icon left of
label & entry.
2004-07-19 Michael Natterer <mitch@gimp.org>
* app/paint/gimppaintcore.h: removed enum GimpPaintCoreState.
* app/paint/paint-enums.h: added enum GimpPaintState (with values
that have a name space).
* app/paint/gimppaintcore.[ch]
* app/paint/gimpairbrush.c
* app/paint/gimpbrushcore.c
* app/paint/gimpclone.c
* app/paint/gimpconvolve.c
* app/paint/gimpdodgeburn.c
* app/paint/gimperaser.c
* app/paint/gimpink.c
* app/paint/gimppaintbrush.c
* app/paint/gimppaintcore-stroke.c
* app/paint/gimpsmudge.c
* app/tools/gimppainttool.c: changed accordingly.
* app/tools/gimpinktool.c: removed unused #include.
2004-07-19 Sven Neumann <sven@gimp.org>
* app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse):
moved variable declarations to the scope they are being used in,
removed trailing whitespace, minor cleanups.
2004-07-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/core/gimpchannel-combine.c: put in two lines accidentally
omitted in previous change, improve doc comment.
2004-07-19 Michael Natterer <mitch@gimp.org>
* libgimpbase/gimpwin32-io.h: added copyright header, added
#defines for access(), F_OK, R_OK and X_OK.
* app/core/gimpdata.c: include the above instead of defining
the workarounds here.
* app/base/tile-swap.c
* app/config/gimpconfig-dump.c
* libgimpthumb/gimpthumb-utils.c
* libgimpthumb/gimpthumbnail.c: for consistency, #include
gimpwin32-io.h with "" instead of <>.
2004-07-19 Michael Natterer <mitch@gimp.org>
* app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse):
comments not intended for gtk-doc must not start with '/**'.
2004-07-19 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in.h (struct _PlugIn): removed obsolete
compile-time check for GLIB >= 2.3.5.
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
* ChangeLog: Fixed a copy-and-paste error with the dates of my commits.
* plug-ins/gimpressionist/ppmtool.c: removed a few commented-out
asserts, and the function that was used to implement them.
2004-07-19 Michael Natterer <mitch@gimp.org>
* app/widgets/widgets-types.h: reordered and commented to match
API docs.
2004-07-19 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_browse.[ch]: renamed struct member
file_selection to file_chooser.
2004-07-19 Michael Natterer <mitch@gimp.org>
* app/config/config-types.h: removed GimpConfigInterface typedef,
added comments to typedefs which don't belong here.
* app/config/gimpconfig.h: added GimpConfigInterface typedef.
* app/core/core-types.h
* app/display/display-types.h: added commented out typedefs for
types that live in config-types.h for obscure reasons.
* app/core/core-types.h: reordered stuff to match the order in the
API docs (makes keeping stuff in sync much easier).
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/repaint.c: replaced a few if's+destructors
pairs for ppm_ with just the destructors.
2004-07-19 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/repaint.c: normalized some identifiers of
repaint.c, and corrected some indentation there.
2004-07-18 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/core/gimpchannel-combine.c: improve anti-aliasing for
elliptical selections, as described in bug #147836.
2004-07-18 Sven Neumann <sven@gimp.org>
* app/composite/gimp-composite-mmx.h: don't start a comment with
/** unless it's meant to be parsed by gtk-doc.
* app/actions/Makefile.am:
* app/actions/file-dialog-commands.[ch]: removed, not used any
longer.
2004-07-18 Philip Lafleur <plafleur@cvs.gnome.org>
* app/paint/gimpink-blob.c (blob_make_convex): Check if the
array index is legal before using it, not the other way around.
Fixes bug #144856.
2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/common/polar.c (dialog_update_preview): Fixed a
write to unallocated memory that was causing crashes in various
spots.
2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/common/polar.c (polarize_func): moved array
initialization out of variable declaration. Fixes bug #147799.
2004-07-17 Michael Natterer <mitch@gimp.org>
* app/widgets/gimphelp-ids.h: added the removed help IDs back.
* app/widgets/gimpfileprocview.[ch]: cache all file_procs' help
IDs and added gimp_file_proc_view_get_help_id() which returns the
selected item's help ID.
* app/widgets/gimpfiledialog.c: added a custom help func which
shows the help for the selected file_proc if the proc_view has the
focus.
2004-07-17 Sven Neumann <sven@gimp.org>
* app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB
for "file-open-location".
* app/widgets/gimpfiledialog.c: create the scrolled window with
shadow_type GTK_SHADOW_IN.
* app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip
procedures that register a prefix (the URL loader).
* app/widgets/gimphelp-ids.h: removed help IDs that used to be
used from the file-open and file-save menus.
* plug-ins/common/xwd.c (query): "X window dump" seems to be more
appropriate than "X window image".
2004-07-17 Sven Neumann <sven@gimp.org>
* app/actions/Makefile.am
* app/actions/file-dialog-actions.[ch]
* app/actions/file-open-actions.[ch]
* app/actions/file-save-actions.[ch]: these aren't needed any
longer.
* app/actions/actions.c: changed accordingly.
* app/menus/Makefile.am
* app/menus/file-dialog-menu.[ch]
* app/menus/file-open-menu.[ch]
* app/menus/file-save-menu.[ch]: these aren't needed any longer.
* app/menus/menus.c: changed accordingly.
* menus/Makefile.am
* menus/file-open-menu.xml
* menus/file-save-menu.xml: these are also not needed any longer.
2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/bmp/bmpwrite.c (WriteImage): Applied a patch from
Brion Vibber that fixes corruption when saving RLE-encoded
BMPs on big endian hosts. Fixes bug #147759.
2004-07-17 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: normalized the identifiers of
general.c and general.h. Also, renamed a callback from _store
to simply _callback to avoid confusion with the _store methods.
Some of the member variables of the pcvals struct were changed
as a result.
2004-07-16 Helvetix Victorinox <helvetix@gimp.org>
* app/composite/gimp-composite-mmx.[ch]
* app/composite/gimp-composite-sse.[ch]
* app/composite/gimp-composite-sse2.[ch]:
We've had trouble compiling with the Intel compiler which
identifies itself as GCC, but doesn't support the same extended
assembly features/misfeatures as GCC. With the help of the Intel
compiler group, we've determined that the Intel compiler can be
identified at compile time by the definition of the preprocessor
variable __INTEL_COMPILER.
These changes make all of the assembly code currently written to
simply avoid the Intel compiler.
This is an interim solution to get a build working despite the
Intel compiler. A more correct solution has been identified, see
the discussion of bug #147013 for more information.
2004-07-17 Sven Neumann <sven@gimp.org>
* app/xcf/xcf.c (xcf_init): also register the internal XCF
handlers according to the new scheme.
* plug-ins/common/Makefile.am
* plug-ins/common/plugin-defs.pl
* plug-ins/common/hrz.c: removed the HRZ file plug-in since it
doesn't seem to be very useful.
2004-07-17 Sven Neumann <sven@gimp.org>
* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add)
(plug_ins_init_file): use g_slist_prepend() instead of
g_slist_append().
* plug-ins/common/url.c (query): ported to the new PDB registration
scheme.
2004-07-16 Sven Neumann <sven@gimp.org>
* app/plug-in/plug-ins.c (plug_ins_init): sort the file procedures
by their menu labels.
* app/widgets/gimpfileprocview.c: removed the sort function here.
2004-07-16 Sven Neumann <sven@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpfileprocview.[ch]: added new widget that offers
a treeview on file procedures.
* app/widgets/gimpfiledialog.[ch]: replaced the file type option
menu with the new GimpFileProcView widget.
(gimp_file_dialog_set_image): reset the file type to Automatic
(fixes bug #141535).
* app/actions/file-commands.c
* app/gui/file-open-dialog.[ch]
* app/gui/file-save-dialog.[ch]: changed accordingly.
* plug-ins/common/bz2.c
* plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2"
extension. It's redundant and breaks the code that sets the
extension from the selected file-type.
* plug-ins/common/dicom.c: register a shorter menu label.
* plug-ins/common/gbr.c
* plug-ins/common/gih.c
* plug-ins/common/pat.c
* plug-ins/common/url.c: register stock icons.
2004-07-16 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/Lighting/lighting_main.[ch]
* plug-ins/Lighting/lighting_preview.[ch]
* plug-ins/Lighting/lighting_shade.c
* plug-ins/Lighting/lighting_ui.c: Made this plug-in support
multiple light sources; implemented three, architecture now
supports any number. Changed material properties to more intuitve
names; added "metallic" property. Cleaned out some unused,
commented-out code.
2004-07-16 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb.pl: include "libgimpbase/gimpbase.h" instead of
"libgimpbase/gimpparasite.h" for getting the GimpParasite type.
* tools/pdbgen/app.pl
* tools/pdbgen/pdb/drawable.pdb
* tools/pdbgen/pdb/edit.pdb
* tools/pdbgen/pdb/gradients.pdb
* tools/pdbgen/pdb/guides.pdb
* tools/pdbgen/pdb/image.pdb: removed redundant #includes.
* tools/pdbgen/pdb/plug_in.pdb: standardized "success" logic.
Consistently fail if there is no currently queried plugin.
* app/pdb/*.c: regenerated.
2004-07-16 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell-transform.c: made gtk-doc even
happier; clarified meaning of the "use_offsets" parameter.
2004-07-16 Sven Neumann <sven@gimp.org>
* app/core/gimpdata.c:
* app/display/gimpcanvas.c:
* app/display/gimpdisplayshell.c
* app/display/gimpdisplayshell-transform.c: corrected API
documentation, removed trailing whitespace.
Please do always build the documentation if you add or change any
gtk-doc comments.
2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/display/gimpcanvas.c:
* app/display/gimpdisplayshell-transform.c: added gtk-doc
comments for all public functions that lack them.
* app/display/gimpdisplayshell.c: added a couple of
gtk-doc comments.
2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/core/gimpdata.c: added gtk-doc comments for
public functions.
2004-07-15 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: normalized the identifiers of
paper.c and paper.h. Made one variable local to the function
instead of module static.
2004-07-15 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: normalized the ppmtools.c and
ppmtool.h identifiers. Also fixed some (but not all) of the
syntax.
2004-07-15 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/winicon/icoload.c:
* plug-ins/winicon/icosave.c: Applied a patch from Brion Vibber
that fixes byte-swapping on big endian hosts. Fixes bug #147610.
2004-07-15 Sven Neumann <sven@gimp.org>
* plug-ins/helpbrowser/dialog.c
* plug-ins/helpbrowser/uri.c: don't warn if no help pages are
installed and the Home button is clicked.
2004-07-15 Michael Natterer <mitch@gimp.org>
* app/file/file-open.c (file_open_layer): don't crash if no
layer or only one layer is visible. Fixes bug #143804.
* app/app_procs.c (app_run): fixed log domain registration.
2004-07-15 Michael Natterer <mitch@gimp.org>
* app/core/gimpviewable.[ch]: corrected API docs and fixed
function parameter names to silent gtk-doc warnings.
2004-07-15 Michael Natterer <mitch@gimp.org>
* app/app_procs.c (app_run): register a log handler for the
"Gimp-Menus" domain.
2004-07-15 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/common/mng.c: cleanup.
2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/core/gimpviewable.c: added gtk-doc comments for public
functions.
2004-07-15 Michael Natterer <mitch@gimp.org>
* app/actions/file-commands.h: reordered to match the .c file.
* app/core/gimpitem.c
* app/vectors/gimpvectors-import.c: fixed API docs.
2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/common/png.c:
* plug-ins/common/mng.c: Fixed erroneously reported warning
message when saving indexed layers with an alpha channel but
no transparent pixels.
2004-07-14 Sven Neumann <sven@gimp.org>
* app/app_procs.c (app_run): register a log handler for the
"Gimp-Actions" domain.
2004-07-14 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/objects.txt: . . . and removed because it is
redundant with devel-docs/app/app.hierarchy.
2004-07-14 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* devel-docs/objects.txt: added file containing a map of Gimp's
GObject hierarchy .
2004-07-14 Michael Natterer <mitch@gimp.org>
* app/display/gimpstatusbar.[ch]: massively changed: removed
message_ids, the message mem chunk and all signals. Added new
function gimp_statusbar_replace() which updates a message without
moving it to the top of the stack. Fixes bug #120175.
* app/display/gimpdisplayshell-title.[ch]: renamed
gimp_display_shell_update_title() to
gimp_display_shell_title_update() and switched from pop()/push()
to replace() so the title message keeps its place in the stack.
Added new function gimp_display_shell_title_init() which push()es
the title message to the stack.
* app/display/gimpdisplayshell.c (gimp_display_shell_new): call
gimp_display_shell_title_init() so the "title" message is at the
bottom of the stack.
* app/display/gimpdisplayshell-callbacks.c
* app/display/gimpdisplayshell-handlers.c: changed accordingly.
2004-07-14 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-console.[ch]
* plug-ins/script-fu/script-fu.c
* plug-ins/script-fu/siod-wrapper.[ch]
* plug-ins/script-fu/siod/slib.c: applied a patch from Kevin
Cozens that removes an unneeded pipe which was causing problems
on long output from the SIOD interpreter (bug #139200). Also
shortened the welcome message.
2004-07-14 Sven Neumann <sven@gimp.org>
* plug-ins/pagecurl/pagecurl.c: GUI polishing.
2004-07-14 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: Added more underscores to identifiers.
Fixed some of the style issues (added whitespace before the '(' in
function calls).
2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/common/mng.c: Now writes a global palette chunk, and
empty palette chunks for the frames that use it. This saves a
bit of diskspace.
2004-07-14 Michael Natterer <mitch@gimp.org>
* app/core/gimpimage.c: added properties "gimp", "id", "width",
"height" and "base-type". Moved all code from gimp_image_new()
to GObject::constructor().
* app/core/gimpimage-convert.c
* app/core/gimpimage-crop.c
* app/core/gimpimage-resize.c
* app/core/gimpimage-rotate.c
* app/core/gimpimage-scale.c
* app/core/gimpimage-undo-push.c: set "width", "height" and
"base-type" with g_object_set() so "notify" is emitted on the
properties.
* app/core/gimpimage-undo.c (gimp_image_undo_pop_stack):
freeze/thaw property notifications around undoing/redoing so they
are not emitted in the middle of the undo operation.
2004-07-14 Michael Natterer <mitch@gimp.org>
* app/core/gimpitem.c: converted tabs to spaces, cleanup,
reviewed new API docs.
2004-07-14 Sven Neumann <sven@gimp.org>
* plug-ins/common/tiff.c: applied a patch done by Brion Vibber
and Philip Lafleur that fixes loading of CMYK TIFF images on
big-endian hardware (bug #147328).
2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/common/mng.c (respin_cmap): Properly check the return
value of find_unused_ia_color(). The plugin will now save indexed
MNGs correctly; fixes bug #139947. Also converted tabs to spaces.
2004-07-14 Michael Natterer <mitch@gimp.org>
Code review & cleanup:
* app/config/gimpguiconfig.[ch]: removed transparency-size,
transparency-type and snap-distance properties...
* app/config/gimpdisplayconfig.[ch]: ...and added them here.
* app/display/gimpdisplayshell.c
* app/tools/gimpmovetool.c: changed accordingly.
* app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
"max_memsize" parameter instead of looking it up in GimpGuiConfig.
* app/actions/image-commands.c: changed accordingly.
* app/core/gimparea.c
* app/core/gimpdrawable.c: converted tabs to spaces, cleanup.
* app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
GimpProjectionIdleRender, reordered functions, cleanup.
* app/display/gimpdisplay-handlers.c
* app/display/gimpdisplay.c: removed unused #includes.
* app/display/gimpdisplayshell.[ch]
* app/display/gimpdisplayshell-close.c: renamed
shell->warning_dialog to shell->close_dialog, some random
cleanups.
* app/display/gimpdisplayshell-handlers.c
* app/widgets/gimpselectioneditor.c: minor coding style cleanup.
2004-07-13 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/core/gimpitem.c: added documentation comments to some
of the functions.
2004-07-14 Michael Natterer <mitch@gimp.org>
* app/display/Makefile.am
* app/display/gimpdisplayshell-close.[ch]: new files for
gimp_display_shell_close() and its dialog & callback.
* app/display/gimpdisplayshell.[ch]: removed from here.
* app/actions/view-actions.c (view_close_view_cmd_callback):
changed accordingly.
2004-07-14 Sven Neumann <sven@gimp.org>
* plug-ins/pagecurl/pagecurl.c: code cleanup. Use enums instead of
a plethora of booleans. Added some macros for readability. Allow
to use a reversed gradient for colorizing the curl.
2004-07-14 Michael Natterer <mitch@gimp.org>
* app/core/Makefile.am
* app/core/core-types.h
* app/core/gimppickable.[ch]: new interface which has
get_image_type(), get_tiles() and get_color_at() methods.
* app/core/gimpdrawable.[ch]
* app/core/gimpimagemap.[ch]
* app/core/gimpprojection.[ch]: implement GimpPickableInterface
and removed public get_colot_at() functions.
* app/core/gimpimage-pick-color.[ch]: removed typedef
GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use
gimp_pickable_pick_color() instead.
* app/core/gimpimage-contiguous-region.c
* app/core/gimpimage-crop.c
* app/gui/info-window.c
* app/paint/gimpconvolve.c
* app/paint/gimpsmudge.c
* app/tools/gimpbycolorselecttool.c
* app/tools/gimpimagemaptool.c
* app/widgets/gimpselectioneditor.c: use GimpPickable functions
instead of the various get_color_at() functions. Simplifies code
which has a "sample_merged" boolean. Various cleanups.
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/presets.c: Added underscores between
words in function names according to the GIMP's (and common
sense) convention.
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: Moved the global declarations of
img_has_alpha and create_colorpage to more specialized headers.
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/: Added the paper.h header for the functions
defined in the paper.c module. (thus removing more declarations
from gimpressionist.h)
2004-07-13 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-preview.[ch}
* plug-ins/gfig/gfig.h: Made Cancel work properly. Moved "show grid",
"snap to grid", and "show image" checkbuttons back onto main
interface. Eliminated GtkPreview and removed undef of
GTK_DISABLE_DEPRECATED from gfig-preview.c. Removed some
unused code.
2004-07-13 Sven Neumann <sven@gimp.org>
* plug-ins/gflare/gflare.c (preview_handle_idle): use
gtk_widget_queue_draw_area() instead of the deprecated
gtk_widget_draw() routine.
* plug-ins/gimpressionist/orientmap.c
* plug-ins/gimpressionist/paper.c
* plug-ins/gimpressionist/sizemap.c: use gtk_widget_queue_draw()
instead of the deprecated gtk_widget_draw() routine.
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/preview.c
* plug-ins/gimpressionist/sizemap.c:
eliminated two compile-time warnings.
2004-07-13 Michael Natterer <mitch@gimp.org>
Added a GimpProjection object which maintains the idle projection
logic that was in GimpDisplay and takes care of constructing the
projection even without any display open. Makes color picking and
other reads from the projection work without display and fixes the
major bug that we were constructing the projection n times (!)
for n displays.
* app/core/Makefile.am
* app/core/gimpimage-projection.[ch]: removed.
* app/core/core-types.h
* app/core/gimpmarshal.list
* app/core/gimparea.[ch]
* app/core/gimpprojection.[ch]
* app/core/gimpprojection-construct.[ch]: new files assembled from
the pieces of gimpdisplay.c and gimpimage-projection.c.
* app/core/gimpimage.[ch]: create a GimpProjection.
Removed explicit projection realloc calls because the projection
connects to the relevant GimpImage signals now.
Added gimp_image_coords_in_active_drawable().
* app/display/Makefile.am
* app/display/gimpdisplay-area.[ch]: removed.
* app/display/gimpdisplay.[ch]: stripped away the idle render stuff
and just keep a list of update_areas which is painted on flush().
Removed gimp_display_coords_in_active_drawable().
* app/display/gimpdisplay-foreach.[ch]: removed
gimp_display_finish_draw().
* app/core/gimpchannel.c
* app/core/gimpimage-contiguous-region.c
* app/core/gimpimage-convert.c
* app/core/gimpimage-crop.c
* app/core/gimpimage-merge.c
* app/core/gimpimage-pick-color.c
* app/core/gimpimage-scale.c
* app/core/gimppalette-import.c
* app/display/gimpdisplay-handlers.c
* app/display/gimpdisplayshell-render.c
* app/display/gimpdisplayshell.c
* app/gui/info-window.c
* app/tools/gimpbucketfilltool.c
* app/tools/gimpbycolorselecttool.c
* app/tools/gimpclonetool.c
* app/tools/gimpcolortool.c
* app/tools/gimpeditselectiontool.c
* app/tools/gimpfliptool.c
* app/tools/gimpimagemaptool.c
* app/tools/gimpiscissorstool.c
* app/tools/gimppainttool.c
* app/tools/gimpselectiontool.c
* app/tools/gimptransformtool.c
* app/widgets/gimpselectioneditor.c: changed accordingly.
2004-07-13 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppixmap.[ch]: declared GimpPixmap as deprecated.
* libgimpwidgets/gimpwidgets.[ch]: ditto for gimp_pixmap_button_new().
* plug-ins/Lighting/ChangeLog: removed outdated and unused ChangeLog.
* plug-ins/Lighting/Makefile.am
* plug-ins/Lighting/*.xpm: removed XPM files...
* configure.in
* plug-ins/Lighting/images: ... and added them as PNG images here.
These should be redone with antialiased edges.
* plug-ins/Lighting/lighting_stock.[ch]
* plug-ins/Lighting/lighting_ui.c: register stock icons and use
those instead of GimpPixmaps.
* plug-ins/MapObject/Makefile.am
* plug-ins/MapObject/*.xpm: removed duplicated XPM files.
* plug-ins/MapObject/mapobject_stock.[ch]: register stock icons
reusing the generated header from the Lighting plug-in.
* plug-ins/MapObject/mapobject_ui.c: use them.
* plug-ins/pagecurl/pagecurl.c: undef GIMP_DISABLE_DEPRECATED until
GimpPixmap has been replaced here as well.
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/presets.c: fixed bug #147483 (gimpressionist
will delete global presets if the user running GIMP has priviliges to
do so). This was done by creating a function to check if a preset is
global, and by making sure the delete button is in-sensitive when
this is the case.
2004-07-13 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpcolorbutton.c
* libgimpwidgets/gimpcolornotebook.c
* libgimpwidgets/gimpcolorscale.c
* libgimpwidgets/gimpcolorscales.c
* libgimpwidgets/gimpcolorselect.c
* libgimpwidgets/gimpcolorselection.c
* libgimpwidgets/gimpframe.c
* libgimpwidgets/gimppickbutton.c
* libgimpwidgets/gimpunitmenu.c: some code review and cosmetics.
2004-07-13 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/*.[ch]: normalized some of brush.c's
identifiers (= variable names and function name)
2004-07-13 Sven Neumann <sven@gimp.org>
* app/core/gimp-utils.c (gimp_g_value_get_memsize): handle NULL
string values.
2004-07-13 Sven Neumann <sven@gimp.org>
* plug-ins/common/jpeg.c: override the output_message error
handler in order to propagate warnings to the user interface
(related to bug #145212).
2004-07-13 Sven Neumann <sven@gimp.org>
* app/core/gimp-utils.[ch]: added new function
gimp_g_value_get_memsize() that attempts to calculate the memory
requirements for a GValue.
* app/text/gimptextundo.c (gimp_text_undo_get_memsize): use the
new function to obtain a better estimate for the size of the text
undo.
2004-07-13 Sven Neumann <sven@gimp.org>
* app/tools/gimptexttool.c (gimp_text_tool_create_layer): plugged
a tiny memory leak.
2004-07-13 Sven Neumann <sven@gimp.org>
* app/core/gimpimage-undo.c: resurrected some bit-rotting debug
code. Might become useful one day.
2004-07-13 Sven Neumann <sven@gimp.org>
* autogen.sh: when automake 1.8 is being used, require at least
version 1.8.3. Earlier versions of the automake-1.8 series don't
handle gimp-console correctly.
2004-07-13 Michael Natterer <mitch@gimp.org>
* app/config/gimpconfig-dump.c
* app/display/gimpdisplayshell-title.c
(gimp_display_shell_format_title): applied patch from Dave Neary
which adds %B which expands to (modified) if the image is
dirty. Also added %A which expands to (clean) because we also have
a short indicator for the clean image. Fixes bug #130943.
2004-07-13 Sven Neumann <sven@gimp.org>
* app/Makefile.am: removed hack for gimp-console compilation.
automake seems to handle it correctly all by itself.
2004-07-12 Michael Schumacher <schumaml@cvs.gnome.org>
* app/app_procs.c: added
#ifdef G_OS_WIN32
#include <windows.h>
#endif
2004-07-12 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpbufferview.[ch]: added a preview of the global
buffer.
2004-07-12 Sven Neumann <sven@gimp.org>
* app/Makefile.am: make sure that gimp-console is enabled for
'make dist'. Use it to dump the system gimprc and gimprc man-page.
2004-07-12 Michael Natterer <mitch@gimp.org>
* app/text/gimptextundo.[ch]: removed member "guint time"...
* app/core/gimpundo.[ch]: ...and added it here.
* app/tools/gimptexttool.c (gimp_text_tool_apply): changed
accordingly. Reordered undo compression code to look like other
pieces of code which do undo compression.
2004-07-12 Michael Natterer <mitch@gimp.org>
* app/core/gimpundo.[ch]
* app/core/gimpitemundo.[ch]
* app/text/gimptextundo.[ch]: removed all _new() functions and
added properties and GObject::constructor() implementations
instead.
* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added
"GType undo_gtype" parameter and allow to pass name-value pairs as
"...". Use the new GParameter utility functions to construct the
appropriate undo step with g_object_newv().
(gimp_image_undo_push_item): removed.
(gimp_image_undo_push_undo): removed. Merged its code back into
gimp_image_undo_push(), where it originally came from.
* app/core/gimpimage-undo-push.c
* app/core/gimpundostack.c
* app/paint/gimppaintcore-undo.c
* app/tools/gimptransformtool-undo.c
* app/widgets/gimpundoeditor.c: changed accordingly.
2004-07-12 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-preview.c
* plug-ins/gfig/gfig-style.c
* plug-ins/gfig/gfig.c: some include cleanups. Use
libgimpbase/gimpwin32-io.h instead of defining W_OK explicitely.
Don't undef GTK_DISABLE_DEPRECATED except for gfig-preview.c.
2004-07-12 Michael Natterer <mitch@gimp.org>
* plug-ins/script-fu/scripts/round-corners.scm: applied patch from
Dave Neary that changes the behavior from undo disable/enable to
using an undo group if the script doesn't work on a copy of the
image. Fixes bug #146344.
2004-07-12 Michael Natterer <mitch@gimp.org>
* menus/toolbox-menu.xml.in: applied patch from Brion Vibber
which adds <Toolbox>/Acquire/Paste as new. Fixes bug #147358.
2004-07-12 Michael Natterer <mitch@gimp.org>
* app/core/gimp-modules.c: don't do anything if gimp->no_interface
is TRUE.
2004-07-12 Michael Natterer <mitch@gimp.org>
Made the gimp-console binary compile.
Finishes core/GUI separation and fixes bug #71514:
* configure.in: removed the crazy-hacker warning for
--enable-gimp-console.
* app/Makefile.am: for gimp-console, copy app_procs.c to
app_procs_console.c and compile it instead of app_procs.c with
-DGIMP_CONSOLE_COMPILATION
* app/app_procs.[ch]: added some #ifndef GIMP_CONSOLE_COMPILATION
to skip GUI stuff for the gimp-console case.
Renamed app_gui_libs_init() to app_libs_init(), renamed
app_gui_abort() to app_abort() and added app_exit() so everything
that needs #ifdefs lives here now.
* app/main.c: changed accordingly.
* app/gui/gui.c (gui_abort): really abort (call exit()).
2004-07-12 Sven Neumann <sven@gimp.org>
* INSTALL: made the suggestion to use binary packages more
prominent, mention --enable-gimp-console.
2004-07-12 Sven Neumann <sven@gimp.org>
* app/sanity.[ch]: removed the gtk+ sanity check here ...
* app/gui/gui.c: ... and do it here from gui_libs_init().
* app/main.c: changed accordingly.
2004-07-12 Sven Neumann <sven@gimp.org>
* app/app_procs.s: don't use gtk_main() / gtk_main_quit() but run
our own main-loop like we already used to do when being run
non-interactively.
2004-07-12 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdialogfactory.c
(gimp_dialog_factories_set_busy_foreach)
(gimp_dialog_factories_unset_busy_foreach): set/unset the busy
cursor on all windows which have widget->window, not only for
those which are GTK_WIDGET_VISIBLE. Fixes stale busy cursors when
dialogs are hidden while the busy cursor is active and later shown
again.
2004-07-12 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplay.c: added an "id" CONSTRUCT_ONLY
property. Some minor cleanup.
2004-07-12 Michael Natterer <mitch@gimp.org>
* app/core/Makefile.am
* app/core/gimp-gui.[ch]: new files defining a GimpGui vtable
struct and contianing all the vtable wrapper functions. Reordered
and renamed some functions for consistency.
* app/core/gimp.[ch]: removed all the vtable code.
* app/gui/gui-vtable.c: changed accordingly.
2004-07-12 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplay-foreach.c
(gimp_displays_get_dirty_images): remove images from the
container when they become clean. Should move to the Gimp object.
* app/gui/quit-dialog.c: some cosmetic changes.
2004-07-12 Sven Neumann <sven@gimp.org>
* plug-ins/common/tiff.c: applied a patch from Brion Vibber that
sets the 'Save color values from transparent pixels' insensitive
when there's no alpha channel.
2004-07-11 Hans Breuer <hans@breuer.org>
* **/makefile.msc : updated
app/actions/makefile.msc app/menus/makefile.msc : (new files)
app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST
* libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
app/widgets/gimppropwidgets.c : bumped compiler version check,
msvc6 still can't cast from unsigned __int64 to double
* app/actions/debug-actions.c : only use debug_*_callback
and thus debug_action if ENABLE_DEBUG_MENU
* app/core/gimpalette-import.c : added gimpwin32-io.h
* plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/
* plug-ins/common/screenshot.c : make it compile with msvc,
but still no win32 specific implementation ...
2004-07-11 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/gfig/gfig-dobject.h: fix commit error that
broke build.
2004-07-11 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/gfig/gfig-dialog.c
* plug-ins/gfig/gfig-dobject.[ch]
* plug-ins/gfig/gfig.c: added buttons to select an object, and
raise or lower the selected object; also a few minor cleanups.
2004-07-11 Philip Lafleur <plafleur@cvs.gnome.org>
* app/widgets/gimpdevices.c (gimp_devices_check_change): Applied a
patch from Robert Ögren, moved here from toolbox_check_device().
Only change devices if the event came from a widget that accepts
extension events. Fixes bug #115774.
2004-07-11 Michael Natterer <mitch@gimp.org>
* app/core/gimp-utils.[ch] (gimp_parameters_append)
(gimp_parameters_append_valist)
(gimp_parameters_free): new utility functions which create and
destroy GParameter arrays for g_object_newv().
* app/gui/gui-vtable.c (gui_pdb_dialog_new): use them.
2004-07-10 Michael Natterer <mitch@gimp.org>
Removed any remaining GUI dependency from the PDB wrappers:
* app/core/gimp.[ch]: added vtable entries for the display and
help stuff.
* app/widgets/gimphelp.[ch]: renamed gimp_help() to
gimp_help_show().
* app/gui/gui-vtable.c: implement the new display and help vtable
entries.
* tools/pdbgen/pdb.pl
* tools/pdbgen/pdb/display.pdb
* tools/pdbgen/pdb/help.pdb: use the new functions of the Gimp
object instead of using stuff from display/ and widgets/.
* tools/pdbgen/app.pl: removed bad hacks which enabled including
stuff from gui/, display/ and widgets/.
* app/Makefile.am: link widgets-enums.o, display-enums.o and
gimpdisplayoptions.o into the gimp-console binary because they are
needed for the config system and don't depend on any GUI stuff.
* app/pdb/Makefile.am: s/GTK_CFLAGS/GDK_PIXBUF_CFLAGS/
* app/pdb/display_cmds.c
* app/pdb/help_cmds.c: regenerated.
2004-07-10 Sven Neumann <sven@gimp.org>
* app/gui/quit-dialog.c (quit_dialog_new): let the labels line-wrap.
2004-07-10 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplay-foreach.[ch]: added new function
gimp_displays_get_dirty_images().
* app/gui/quit-dialog.c: show a container treeview of all dirty
images in the quit dialog. Still work in progress...
2004-07-09 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* gimp/plug-ins/gfig/gfig-circle.c
* gimp/plug-ins/gfig/gfig-dialog.c
* gimp/plug-ins/gfig/gfig-dobject.c
* gimp/plug-ins/gfig/gfig-ellipse.c
* gimp/plug-ins/gfig/gfig-poly.c
* gimp/plug-ins/gfig/gfig-preview.c
* gimp/plug-ins/gfig/gfig-star.c
* gimp/plug-ins/gfig/gfig-style.c
* gimp/plug-ins/gfig/gfig-style.h
* gimp/plug-ins/gfig/gfig.c
* gimp/plug-ins/gfig/gfig.h: Made FG, BG, and pattern fill work for
fillable objects; other miscellaneous cleanups and minor fixes.
2004-07-09 Sven Neumann <sven@gimp.org>
* app/gui/gui.c: removed the quit dialog code here.
* app/gui/Makefile.am
* app/gui/quit-dialog.[ch]: added new files that hold the old code
for now.
2004-07-09 Michael Natterer <mitch@gimp.org>
* app/pdb/procedural_db.c: #include <glib-object.h> instead of
<gtk/gtk.h>.
2004-07-09 Michael Natterer <mitch@gimp.org>
* app/gui/Makefile.am
* app/gui/brush-select.[ch]
* app/gui/font-select.[ch]
* app/gui/gradient-select.[ch]
* app/gui/palette-select.[ch]
* app/gui/pattern-select.[ch]: removed...
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimppdbdialog.[ch]
* app/widgets/gimpdataselect.[ch]
* app/widgets/gimpbrushselect.[ch]
* app/widgets/gimpgradientselect.[ch]
* app/widgets/gimppaletteselect.[ch]
* app/widgets/gimppatternselect.[ch]
* app/widgets/gimpfontselect.[ch]: ...and added here as a
hierarchy of widgets.
* app/widgets/gimpdatafactoryview.h: removed typdef
GimpDataEditFunc, it's in widgets-types.h now.
* app/gui/convert-dialog.c: changed accordingly.
* app/core/gimp.[ch]: added vtable entries for creating, closing
and setting PDB dialogs.
* app/gui/gui-vtable.c: implement the vtable entries using the new
widgets.
* tools/pdbgen/pdb/brush_select.pdb
* tools/pdbgen/pdb/font_select.pdb
* tools/pdbgen/pdb/gradient_select.pdb
* tools/pdbgen/pdb/palette_select.pdb
* tools/pdbgen/pdb/pattern_select.pdb: use the new functions of
the Gimp object to create / manage the selection dialogs. The
generated files don't depend on GUI stuff any longer.
* app/pdb/brush_select_cmds.c
* app/pdb/font_select_cmds.c
* app/pdb/gradient_select_cmds.c
* app/pdb/palette_select_cmds.c
* app/pdb/pattern_select_cmds.c: regenerated.
2004-07-09 Sven Neumann <sven@gimp.org>
* app/gui/file-save-dialog.c (file_save_overwrite): improved text
of the dialog.
2004-07-09 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpdialog.c (gimp_dialog_class_init): document
that "help-func" and "help-id" properties have been added for 2.2.
2004-07-09 Sven Neumann <sven@gimp.org>
* app/widgets/gimphistogrameditor.c
(gimp_histogram_editor_menu_update): reverted my last change.
(gimp_histogram_editor_item_visible): fix the problem here instead.
2004-07-08 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpdialog.c: removed "role" property because
GtkWindow has an equivalent property now. Added "help-func" and
"help-id" construct properties.
* app/widgets/gimptexteditor.c
* app/widgets/gimptooldialog.c
* app/widgets/gimpviewabledialog.c: removed calls to
gimp_help_connect() and pass help_func and help_id to
g_object_new().
2004-07-08 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimphelpui.c (gimp_context_help): fixed typo in
API docs.
2004-07-08 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist/Presets: converted the newlines in the
descriptions to whitespaces, so they'll simply wrap (in accordance
with making the description label wrappable).
2004-07-08 Shlomi Fish <shlomif@iglu.org.il>
* plug-ins/gimpressionist: Various Gimpressionist Cleanups. Made most
remaining non-static global variables static, and created functions
that manipulate them. Created new headers. Renamed some variables and
functions to make their names more menanigful.
2004-07-08 Sven Neumann <sven@gimp.org>
* app/widgets/gimphistogrameditor.c
(gimp_histogram_editor_menu_update): set the active item of the
combo-box after changing the visibility filter.
2004-07-08 Michael Natterer <mitch@gimp.org>
* app/widgets/gimppropwidgets.c (gimp_prop_boolean_combo_box_notify):
same fix as below.
2004-07-08 Sven Neumann <sven@gimp.org>
* app/widgets/gimppropwidgets.c (gimp_prop_enum_combo_box_notify):
block gimp_prop_enum_combo_box_callback() before changing the
combo-box.
2004-07-08 Sven Neumann <sven@gimp.org>
* app/widgets/gimpsessioninfo.c: only write aux-info for properties
that have been changed from their default values.
* app/widgets/gimphistogrameditor.c: some code cleanup.
2004-07-08 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpselectiondata.[ch]: added a "const gchar *format"
parameter to gimp_selection_data_set_pixbuf() which selects the
format in which to encode the pixbuf (was defaulting to "png"
before).
* app/widgets/gimpclipboard.c: when copying, offer all formats which
are savable with GdkPixbuf. Added a GimpClipboard struct which is
attached to the Gimp and which stores all the persistent data
needed by the clipboard. Renamed some private functions.
(unfortunately this change breaks pasting to AbiWord:
http://bugzilla.abisource.com/show_bug.cgi?id=7068)
2004-07-08 Sven Neumann <sven@gimp.org>
* app/config/gimpconfig-deserialize.c
* app/config/gimpconfig-serialize.c: removed redundant casts.
* app/widgets/gimpsessioninfo.[ch]: added convenience functions to
get and set aux-info based on object properties.
* app/widgets/gimphistogrameditor.c: use the new functions to save
a histogram's channel and scale in the sessionrc.
2004-07-07 Sven Neumann <sven@gimp.org>
* app/widgets/gimpclipboard.c: sort the list of pixbuf formats so
that PNG is the preferred format and GIF and JPEG come last.
2004-07-07 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/gfig/*.[ch]: Use single centralized functions to
create, load, and save objects, instead of separate functions
for each type of object. A few other miscellaneous fixes.
2004-07-07 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpclipboard.[ch]: changed to allow pasting any
GdkPixbuf supported format (makes pasting from OpenOffice
work). Cleaned up a bit to perpare pasting of SVG data.
2004-07-07 Sven Neumann <sven@gimp.org>
* app/core/gimplayer.c (gimp_layer_new_from_tiles): add an alpha
channel if the src tile-manager doesn't have one. Warn on
unsupported type conversions instead of silently doing the wrong
thing. Fixes bug #145482.
* app/core/gimpbuffer.c: cosmetics.
2004-07-07 Michael Natterer <mitch@gimp.org>
* app/gui/Makefile.am
* app/gui/clipboard.[ch]: removed...
* app/widgets/Makefile.am
* app/widgets/gimpclipboard.[ch]: ...and added here.
* app/actions/edit-commands.c
* app/gui/gui.c: changed accordingly.
2004-07-07 Michael Natterer <mitch@gimp.org>
Made the undo system robust against the currently pushed undo
being too large according to prefs settings. Fixes bug #145379.
* app/core/gimpimage-undo.[ch] (gimp_image_undo_push_undo)
(gimp_image_undo_group_end): emit "undo-event" *before* calling
gimp_image_undo_free_space() so the undo history doesn't try to
remove an item that has never been added.
(gimp_image_undo_push_undo): added boolean return value indicating
if the undo could be pushed (FALSE means the undo was to large
and was discarded right away).
(gimp_image_undo_push_item): return NULL if the above returned
FALSE.
* app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer):
changed accordingly.
2004-07-07 Manish Singh <yosh@gimp.org>
* plug-ins/common/jpeg.c: Don't try to load EXIF data if any warnings
happened, cause that likely means corruption and libexif doesn't
handle that very happily. Addresses bug #145212. Perhaps the error and
warning messages should be propagated to the user in the GUI somehow,
currently they are not.
2004-07-07 Michael Natterer <mitch@gimp.org>
* app/actions/edit-actions.c (edit_actions): added "..." to "Clear
undo history" because it has a confirmation dialog.
* app/actions/edit-commands.c: cleanup: moved static functions to
the end of the file and prototyped them.
2004-07-07 Sven Neumann <sven@gimp.org>
* app/widgets/gimphistogramview.c (gimp_histogram_view_expose):
fixed a drawing bug I introduced earlier today.
2004-07-07 Michael Natterer <mitch@gimp.org>
* app/actions/view-actions.c
* app/actions/view-commands.[ch]: added actions and callbacks for
scrolling the view. Not used in menus but useful for controllers.
2004-07-07 Sven Neumann <sven@gimp.org>
* app/tools/gimpeditselectiontool.c
(gimp_edit_selection_tool_key_press): adapt the arrow key velocity
to the display scale factor. Please test and complain if you
dislike this behaviour.
* themes/Default/images/Makefile.am
* themes/Default/images/stock-color-pick-from-screen-16.png: new
icon drawn by Jimmac.
* libgimpwidgets/gimpstock.[ch]: register the new icon.
* libgimpwidgets/gimppickbutton.c: use it for the screen color
picker instead of reusing the color picker tool icon.
2004-07-06 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/gfig/*.[ch]: a bunch of code clean-up and
debugging. Created "classes" for the objects, and
attached functions to classes rather than objects.
2004-07-06 Sven Neumann <sven@gimp.org>
Added an RGB histogram based on a patch by Tor Lillqvist. Fixes
bug #145401.
* app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export
it to the PDB.
* app/base/gimphistogram.c: implemented histogram functions for
the RGB mode.
* app/base/levels.c
* app/tools/gimpcurvestool.c
* app/tools/gimplevelstool.c
* app/widgets/gimpcolorbar.c
* app/widgets/gimphistogrameditor.c: handle the new enum value.
* app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode,
draw a histogram that shows the RGB channels simultaneously
2004-07-06 Sven Neumann <sven@gimp.org>
* libgimpmodule/gimpmodule.c: comply with C99 aliasing rules.
2004-07-06 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
(gimp_button_menu_position): call gtk_menu_set_monitor() only
for GTK+ < 2.4.4 and added a #warning about it.
2004-07-06 Sven Neumann <sven@gimp.org>
* plug-ins/gimpressionist: applied patch from Shlomi Fish that
fixes confusion of filenames and user-visible object names (bug
#132621). Also removed function remove_trailing_whitespace() that
used to duplicate functionality from GLib and updated
preset_create_filename().
2004-07-06 Michael Natterer <mitch@gimp.org>
* app/widgets/gimppreviewrenderer.c
(gimp_preview_renderer_set_viewable): queue an idle update when
setting the viewable to NULL so the view gets cleared correctly.
(gimp_preview_renderer_idle_update): call
gimp_preview_renderer_update() even if renderer->viewable is NULL
so clearing the viewable gets propagated to the GUI.
Moved clearing the viewable and removing the idle from
GObject::finalize() to GObject::dispose() because calling
set_viewable() with a NULL viewable triggers typechecking casts
and queuing idle functions, which is not nice in finalize().
2004-07-06 Sven Neumann <sven@gimp.org>
* modules/Makefile.am (libcdisplay_proof_la_LIBADD): added back
$(LCMS_LIBS) that I had accidentally removed.
2004-07-06 Sven Neumann <sven@gimp.org>
* app/widgets/gimpvectorstreeview.c (gimp_vectors_tree_view_drag_svg):
return the proper type.
2004-07-06 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainertreeview.c: connect to
"editing-canceled" of the name cell renderer and restore the
original text in the callback. Doesn't work reliably until GTK+
bug #145463 is fixed.
2004-07-05 Sven Neumann <sven@gimp.org>
* app/plug-in/plug-in-rc.c (plug_in_icon_deserialize): fixed a
compiler warning.
* plug-ins/common/dog.c: removed some redundant casts and other
trivial cleanups.
2004-07-06 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcontroller.h: removed #define
GIMP_CONTROLLER_PARAM_SERIALIZE.
* libgimpmodule/gimpmoduletypes.h: added
GIMP_MODULE_PARAM_SERIALIZE instead.
* modules/controller_linux_input.c
* modules/controller_midi.c: changed accordingly.
* modules/cdisplay_colorblind.c
* modules/cdisplay_gamma.c
* modules/cdisplay_highcontrast.c
* modules/cdisplay_proof.c: made the new properties serializable.
2004-07-05 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/Makefile.am (enum_headers): don't scan
app/paint-funcs/paint-funcs-types.h for enums.
* app/paint-funcs/paint-funcs-types.h: removed /*< pdb-skip >*/
* app/core/core-types.h: reordered opaque typedefs to somehow
match the categories in the comments.
2004-07-05 Michael Natterer <mitch@gimp.org>
* app/core/core-types.h: removed enum SizeType.
* app/text/text-enums.h: added it as enum GimpSizeType and added
comment that it's for backward compatibility only.
* tools/pdbgen/Makefile.am
* tools/pdbgen/pdb/text_tool.pdb: changed accordingly.
* libgimp/gimpenums.h
* plug-ins/pygimp/gimpenums.py
* plug-ins/script-fu/script-fu-constants.c
* tools/pdbgen/enums.pl: regenerated (pdbgen insisted on
reordering the enums).
2004-07-05 Michael Natterer <mitch@gimp.org>
* app/core/core-types.h: #define MIN and MAX values for
GimpCoords.pressure, .tilt and .wheel.
* app/display/gimpdisplayshell-callbacks.c
(gimp_display_shell_get_event_coords)
(gimp_display_shell_get_device_coords): use the #defines instead
of hardcoded magic values when CLAMP()ing event or device values.
2004-07-05 Sven Neumann <sven@gimp.org>
* modules/Makefile.am: link all modules with libgimpmodule.
2004-07-05 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/dog.c: improved defaults. use gimp_invert()
instead of rolling own. Use nasty hack to get previews to
work with grayscale images. Accept grayscale images.
2004-07-05 Sven Neumann <sven@gimp.org>
* app/core/gimpdata.[ch] (gimp_data_create_filename): Removed the
basename parameter and use the object name instead. Convert it to
the filesystem encoding.
* app/core/gimpdatafactory.c: changed accordingly.
2004-07-05 Sven Neumann <sven@gimp.org>
* plug-ins/gimpressionist: applied patch from Shlomi Fish that
fixes a number of bugs in the gimpressionst plug-in (bug #145309).
Also added some const qualifiers, cleaned up includes and removed
degtorad() and radtodeg() functions that used to duplicate
functionality from libgimpmath.
2004-07-05 Michael Natterer <mitch@gimp.org>
* app/widgets/gimptemplateview.c
(gimp_template_view_tree_name_edited): removed unused local variables.
2004-07-05 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig-dialog.c: don't g_free() a GdkPixbuf, it's an
object. Removed trailing whitespace.
* plug-ins/gfig/gfig-preview.c (draw_background): fixed declaration.
2004-07-05 Michael Natterer <mitch@gimp.org>
* app/tools/gimpcolorizetool.c (gimp_colorize_tool_initialize):
return TRUE if initialization was successful. Makes the
tool->drawable pointer being set correctly by the calling code and
fixes bugs where colorize was leaving the drawable in a modified
but non-undoable state when cancelling or changing images.
2004-07-05 Sven Neumann <sven@gimp.org>
* modules/cdisplay_proof.c: use object properties for the
configurable values.
2004-07-05 Michael Natterer <mitch@gimp.org>
* app/core/gimpchannel.[ch]: added signal "color-changed" and emit
it in gimp_channel_set_color() and gimp_channel_set_opacity().
* app/core/gimpimage-qmask.[ch]: added new functions
gimp_image_set,get_qmask_color().
* app/core/gimpimage.[ch]: install a "color-changed" handler on
gimage->channels and update gimage->qmask_color when the qmask's
color changes. Fixes bug #145361.
* app/actions/qmask-commands.c: use the new qmask color API.
2004-07-04 Simon Budig <simon@gimp.org>
* app/actions/dialogs-commands.c
* app/display/gimpdisplayshell-dnd.c
* app/gui/preferences-dialog.c
* app/tools/gimppainttool.c
* app/widgets/gimpdeviceinfo.c
* app/widgets/gimpitemtreeview.c
* plug-ins/imagemap/imap_selection.c
* tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
CVS compile with gcc 2.95 again. Mostly double semicolons and
variable declarations after other stuff. Spotted by Martin
Renold.
* app/pdb/gradients_cmds.c: regenerated.
(there is one issue left, see his patch at
http://old.homeip.net/martin/gcc-2.95.diff, I did not
copy the #define va_copy __va_copy, since I don't know
what happens here.)
2004-07-04 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/gfig/gfig-dialog.[ch]:
* plug-ins/gfig/gfig-style.[ch]:
* plug-ins/gfig/notes.txt: New files.
* plug-ins/gfig/*.[ch]: Complete reworking of the gfig plug-in.
See 'notes.txt' for a summary of what has changed, and how to use
it now. Plenty of bugs have been introduced, which will take a
while to straighten out.
2004-07-04 Tor Lillqvist <tml@iki.fi>
* app/core/gimpdrawable-equalize.c (gimp_drawable_equalize): Drop
a couple of unused variables.
* libgimpmodule/gimpmodule.def: Add gimp_module_register_enum.
2004-07-04 Sven Neumann <sven@gimp.org>
* libgimpmodule/gimpmodule.[ch]: added gimp_module_register_enum(),
a function to register an enum type for a GTypeModule.
* modules/cdisplay_colorblind.c: use an object property for the
color deficiency enum.
2004-07-04 Sven Neumann <sven@gimp.org>
* plug-ins/common/channel_mixer.c: don't attempt to store a
pointer to the last used filename in the plug-in parameter
struct. Fixes bug #145380.
2004-07-04 Sven Neumann <sven@gimp.org>
* modules/cdisplay_gamma.c
* modules/cdisplay_highcontrast.c: added object properties for
configurable values.
* app/widgets/gimpcolordisplayeditor.c
* libgimpwidgets/gimpcolordisplaystack.c
* modules/cdisplay_colorblind.c
* modules/cdisplay_proof.c: cosmetic changes.
2004-07-03 Michael Natterer <mitch@gimp.org>
* app/core/gimpcontext.[ch]: added context->serialize_props mask
which enables specifying exactly which properties will be
serialized. Also fixes a bug that prevented undefined properties
from being serialized, breaking tool_options and device status
serialization.
* app/core/gimptoolinfo.c (gimp_tool_info_new): make only the
properties in the tool_info->context_props mask serializable, also
configure/initialize tool_info->tool_options.
* app/tools/gimp-tools.c (gimp_tools_register): removed
tool_options initialization that is now done in
gimp_tool_info_new().
* app/widgets/gimpdeviceinfo.c: make only the properties in
GIMP_DEVICE_INFO_CONTEXT_MASK serializable.
* app/widgets/gimpdevicestatus.c: add the device table to its
parent container again. Fixes "missing" devices.
* app/core/gimptooloptions.c
* app/widgets/gimpdevices.c: cleanup / code review.
2004-07-03 Michael Natterer <mitch@gimp.org>
* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): if
the color tool is enabled, skip cursor hiding entirely.
2004-07-03 Sven Neumann <sven@gimp.org>
* plug-ins/common/dog.c (dog): removed #ifdef'ed code that isn't
any longer needed.
2004-07-02 Philip Lafleur <plafleur@cvs.gnome.org>
* app/tools/gimptransformoptions.[ch]:
* app/tools/gimptransformtool.c:
* app/tools/tools-enums.[ch]: Replaced "Preview" checkbutton with
a combobox with options "Outline", "Grid", "Image", and
"Image + Grid". Addresses bug #108172.
2004-07-02 Sven Neumann <sven@gimp.org>
* app/actions/edit-actions.c: don't let the Paste menu items
sensitivity depend on the availability of clipboard data because
we aren't notified when the GDK clipboard changes.
2004-07-02 Sven Neumann <sven@gimp.org>
* app/gui/Makefile.am
* app/gui/clipboard.[ch]: new files implementing a clipboard for
image data based on GDK_SELECTION_CLIPBOARD (bug #133247).
* app/actions/edit-actions.c
* app/actions/edit-commands.c: use the new clipboard API.
* app/gui/gui.c: initialize and shutdown the clipboard.
* app/core/gimpbuffer.c: cosmetics.
* app/actions/actions.c
* app/menus/menus.c: added sanity checks to exit functions.
* app/display/gimpdisplayshell-dnd.[ch]: let
gimp_display_shell_drop_svg() take a guchar * buffer.
* app/widgets/gimpselectiondata.c (gimp_selection_data_get_pixbuf):
fixed the implementation.
2004-07-02 Michael Natterer <mitch@gimp.org>
* plug-ins/gimpressionist/Makefile.am
* plug-ins/gimpressionist/*.[ch]: applied patch from Shlomi Fish
that massively cleans up gimppressionist (touching all files and
addding some new ones) and adds a simple PDB interface for
selecting one of the previously created presets.
Fixes bugs #145191, #144913 and #144922.
2004-07-01 Sven Neumann <sven@gimp.org>
* configure.in: bumped version number to 2.1.2.
2004-07-01 Michael Schumacher <schumaml@cvs.gnome.org>
* plug-ins/common/align_layers.c: there seems to be no reason why
this plug-in should not work on INDEXED* images, added it to the
registered image types
2004-07-01 Roman Joost <roman@bromeco.de>
* plug-ins/script-fu/scripts/blend-anim.scm
* plug-ins/script-fu/scripts/glossy.scm
* plug-ins/script-fu/scripts/test-sphere.scm: fixed typos
2004-07-01 Sven Neumann <sven@gimp.org>
* app/widgets/gimpselectiondata.[ch]: added (yet unused) functions
gimp_selection_data_[get|set]_pixbuf().
2004-07-01 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpfgbgarea.[ch]: implement GtkWidget::drag_motion()
and set the FG/BG depending on where the color was dropped. Also
set the drag status accordingly so the cursor indicates whether
dropping will have an effect or not. Fixes bug #145219.
2004-07-01 Sven Neumann <sven@gimp.org>
* app/core/gimptemplate.c: do like Liam taught us and use the
golden ratio as default for new images.
2004-06-30 Philip Lafleur <plafleur@cvs.gnome.org>
* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update):
Chain up if the color tool is enabled. This fixes the problem of
the color picker cursor not appearing when using a paint tool
in color picking mode while "Show Paint Tool Cursor" is off.
2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* libgimp/gimpdrawable.c: moved call to
_gimp_tile_cache_flush_drawable() from gimp_drawable_detach() to
gimp_drawable_flush(), to resolve problem described in bug
#145051.
2004-06-30 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-ins.[ch] (plug_ins_init): added a GimpContext
parameter and use it to start plug-ins.
* app/core/gimp.c (gimp_real_restore): pass the user context.
Restores script-fu's access to the global FG, FG, brush, ...
2004-06-30 Sven Neumann <sven@gimp.org>
* app/core/core-enums.c
* app/display/display-enums.c
* app/paint/paint-enums.c
* app/text/text-enums.c
* app/widgets/widgets-enums.c: regenerated.
2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/actions/file-commands.c: revert previous change that was
intended to fix bug #141971.
2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/*/*-enums.h: did HIG-compliant capitalization in the right
place, instead of the auto-generated *-enums.c files.
2004-06-30 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdnd.[ch]
* app/widgets/gimpselectiondata.[ch]
* app/widgets/gimpcontainertreeview.[ch]: changed "files" and "uris"
to "uri_list" in all function names, parameters and typedefs.
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpdocumentview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimptoolbox-dnd.c
* app/display/gimpdisplayshell-dnd.[ch]
* app/display/gimpdisplayshell.c: changed accordingly.
2004-06-30 Sven Neumann <sven@gimp.org>
* plug-ins/maze/maze_face.c: made the dialog look a little less
clumsy.
2004-06-30 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/drawable.pdb
* libgimp/gimppixbuf.c: raised the maximum size for thumbnails
from 256 to 512 pixels.
* app/pdb/drawable_cmds.c
* libgimp/gimpdrawable_pdb.c: regenerated.
* plug-ins/gfig/gfig-preview.c
* plug-ins/gfig/gfig.c: redone Bill's fix using
gimp_image_get_thumbnail(). A lot simpler, renders the alpha
checkerboard and also works for grayscale images.
2004-06-30 Michael Natterer <mitch@gimp.org>
Fixed a 1.2 -> 2.0 regression that was forgotten:
* app/widgets/widgets-enums.[ch]: added enum GimpColorPickState
which can be one of { NEW, UPDATE }.
* app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function
gimp_palette_editor_update_color() to
gimp_palette_editor_pick_color() and restored the functionality of
creating/updating colors via this API
Changed button_press handler to only edit the color on double
click if it's really a double click on the same color.
Fixes bug #141381.
* app/tools/gimpcolorpickeroptions.[ch]: added boolean property
"add-to-palette" and a GUI for it.
* app/core/gimpmarshal.list
* app/tools/gimpcolortool.[ch]: added a GimpColorPickState
parameter to the "color_picked" signal. Pass NEW on button_press
and UPDATE on motion.
* app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked)
* app/tools/gimplevelstool.c (gimp_levels_tool_color_picked)
* app/tools/gimppainttool.c (gimp_paint_tool_color_picked):
changed accordingly
* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked):
If "add-to-palette" is TRUE, get the palette editor and call
gimp_palette_editor_pick_color().
2004-06-30 Sven Neumann <sven@gimp.org>
* app/widgets/gimpselectiondata.[ch]: renamed the SVG related
functions so that they deal with an anonymous data stream that
could as well be a PNG image.
* app/widgets/gimpdnd.[ch]
* app/widgets/gimpcontainertreeview-dnd.c: changed accordingly.
* app/display/gimpdisplayshell-dnd.[ch]
* app/vectors/gimpvectors-import.[ch]
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpvectorstreeview.c: use gsize for the length of
the buffer.
* app/widgets/gimpdnd.[ch]
* app/widgets/widgets-enums.[ch]: added GIMP_DND_TYPE_PNG which isn't
used yet.
2004-06-30 Michael Natterer <mitch@gimp.org>
* app/core/gimppalette.[ch] (gimp_palette_add_entry): take
const GimpRGB* instead of just GimpRGB*.
Converted tabs to spaces.
2004-06-30 Michael Natterer <mitch@gimp.org>
* widgets/gimpselectiondata.[ch] (gimp_selection_data_get_svg):
changed return value from gchar* to const gchar*. Renamed
parameters to be consistent with other SVG functions.
* widgets/gimpcontainertreeview-dnd.c
* widgets/gimpdnd.c: changed accordingly.
2004-06-30 Simon Budig <simon@gimp.org>
* app/vectors/gimpstroke.[ch]
* tools/pdbgen/pdb/paths.pdb: Applied a modified patch from
Geert Jordaens that implements the gimp-path-get-point-at-dist
PDB function (fixes bug #138754).
* app/pdb/paths_cmds.c: regenerated.
2004-06-30 Michael Natterer <mitch@gimp.org>
* app/widgets/gimptoolbox.c (gimp_toolbox_button_accel_changed):
do like GtkAccelLabel does and turn underscores in accels into
spaces so e.g. "Page_Up" becomes "Page Up".
2004-06-29 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell.c: reordered drop destinations
so vectors are preferred over SVG.
* app/vectors/gimpvectors-import.[ch]: added "gint position"
parameter to all import functions so the imported vectors can be
added at any position in the vectors stack.
* app/actions/vectors-commands.c
* app/display/gimpdisplayshell-dnd.c
* tools/pdbgen/pdb/paths.pdb: changed accordingly (pass -1 as
position).
* app/pdb/paths_cmds.c: regenerated.
* app/widgets/gimpvectorstreeview.c: implemented SVG DND from and
to the paths dialog.
2004-06-29 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainertreeview-dnd.c: don't free the SVG data
after dropping, it's owned by GtkSelectionData.
2004-06-29 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdnd.c: use gtk_target_list_add() instead of
gtk_target_list_add_table() because the latter prepends the
targets to the internal list which screws the order (== priority)
of DND targets.
* app/widgets/gimpselectiondata.c: added some more checks for
failed drops (selection_data->length < 0).
2004-06-29 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/common/unsharp.c: The preview's row buffer was
accidentally made way too large.
2004-06-29 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpwidgets-utils.[ch]: added new function
gimp_get_mod_string() which takes a GdkModifierType and returns
correctly formated strings for all shift,control,alt combinations.
* app/tools/gimpbucketfilloptions.c
* app/tools/gimpcolorpickeroptions.c
* app/tools/gimpconvolvetool.c
* app/tools/gimpcropoptions.c
* app/tools/gimpdodgeburntool.c
* app/tools/gimperasertool.c
* app/tools/gimpflipoptions.c
* app/tools/gimpmagnifyoptions.c
* app/tools/gimpmoveoptions.c
* app/tools/gimptransformoptions.c
* app/tools/gimpvectoroptions.c
* app/widgets/gimpchanneltreeview.c
* app/widgets/gimpcolormapeditor.c
* app/widgets/gimpdocumentview.c
* app/widgets/gimperrorconsole.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimppaletteeditor.c
* app/widgets/gimpselectioneditor.c
* app/widgets/gimpthumbbox.c
* app/widgets/gimptooloptionseditor.c
* app/widgets/gimpvectorstreeview.c: use the new function instead
of gimp_get_mod_name_shift(),control(),alt(),separator(). This
kindof addresses the issue of configurable modifier keys but is
actually indended to ease translation of format strings ("%s" is
easier to get right than "%s%s%s").
2004-06-28 Michael Natterer <mitch@gimp.org>
Allow all sorts of things to be dropped on or in between the
items of a GimpContainerTreeView:
* app/widgets/gimpcontainertreeview.[ch]: added more parameters to
GimpContainerTreeView::drop_possible() to specify where ecactly
the drop should take place (between or into items) and to support
dropping all sorts of things.
Renamed ::drop() to ::drop_viewable() and added ::drop_color(),
::drop_files() and ::drop_svg(), which cover all possible drop
types.
* app/widgets/gimpcontainertreeview-dnd.[ch]: changed accordingly.
Dispatch all kinds of drops to the resp. virtual functions.
* app/widgets/gimpitemtreeview.c: changed accordingly.
* app/widgets/gimplayertreeview.c: allow to drop URIs, colors
and patterns to the layers dialog. Fixes bugs #119506 and #139246.
2004-06-28 Michael Natterer <mitch@gimp.org>
* app/file/file-open.[ch] (file_open_layer): new utility function
which opens an image, flattens it if needed and returns the only
layer, converted for a passed destination image.
* app/display/gimpdisplayshell-dnd.c
(gimp_display_shell_drop_files): use the new function.
2004-06-28 Michael Natterer <mitch@gimp.org>
* app/widgets/Makefile.am
* app/widgets/gimpselectiondata.[ch]: new files containing the
code which encodes/decodes all sorts of stuff to/from its
GtkSelectionData representation. Used to live in gimpdnd.c
* app/widgets/gimpdnd.c: use the new functions (unclutters the
file quite a bit), converted tabs to spaces.
2004-06-28 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainergridview.c:
#include "libgimpwidgets/gimpwidgets.h"
2004-06-28 Michael Natterer <mitch@gimp.org>
Fixed bug #141930 while keeping bug #132322 fixed:
* app/base/curves.c (curves_lut_func)
* app/base/levels.c (levels_lut_func): changed meaning of channel
slots for GRAYA images: just as for GRAY images, expect the value
channel in slot 0 and the alpha channel in slot 1, so it matches
the meaning of slots of GimpHistogram (before this change, only
GRAY images had their value in slot 0 and GRAYA images had it in
slot 1, whereas the histogram had the value channel in slot 0,
which was breaking auto levels for GRAYA images).
* app/tools/gimpcurvestool.c
* app/tools/gimplevelstool.c
* tools/pdbgen/pdb/color.pdb: adjusted channel fiddling for GRAY
and GRAYA images accordingly.
* app/tools/gimpcurvestool.c (curves_update)
* app/tools/gimplevelstool.c (levels_update): call
gimp_color_bar_set_buffers() with the right buffers.
* app/pdb/color_cmds.c: regenerated.
2004-06-28 Sven Neumann <sven@gimp.org>
* app/gui/gui.c (gui_initialize_after_callback): select the
standard tool.
* app/tools/tool_manager.c: cosmetics.
2004-06-28 Michael Natterer <mitch@gimp.org>
* app/tools/gimplevelstool.c: reverted fix for bug #141930. These
hacks are there because the enum used in levels doesn't match
the enum used by the combo box and the histogram widget.
2004-06-28 Michael Natterer <mitch@gimp.org>
* app/tools/gimpclonetool.c (gimp_clone_tool_button_release):
removed again (tools must not draw outside GimpDrawTool::draw()).
(gimp_clone_tool_draw): removed check for gimp_draw_tool_is_active()
because the draw function would not be called if the draw tool was
inactive. Simplified check for whether or not to draw the src
location.
* app/tools/gimppainttool.c (gimp_paint_tool_button_release):
pause/resume the draw tool across all button_release actions so
tools (clone) have a chance to draw different things depending on
gimp_tool_control_is_active(tool->control). Fixes bug #145022.
2004-06-28 Sven Neumann <sven@gimp.org>
* app/actions/actions.c (action_select_object): added missing
return value.
2004-06-28 Sven Neumann <sven@gimp.org>
* plug-ins/common/dog.c: applied HIG rules to the GUI and slightly
rearranged it to get a more compact layout. Applied GIMP coding
style.
2004-06-28 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawable.c: removed wrong note about using
_gimp_tile_cache_flush_drawable() from the API docs.
2004-06-28 Sven Neumann <sven@gimp.org>
* plug-ins/common/dog.c (dog): ifdef'ed out calls to
_gimp_tile_cache_flush_drawable() since it can't be used from a
plug-in. Removed trailing whitespace and redundant includes.
* libgimp/gimp.def: removed _gimp_tile_cache_flush_drawable again.
2004-06-28 Simon Budig <simon@gimp.org>
* app/tools/gimpvectortool.c: fixed drawing code to properly
update after deleting nodes via BackSpace/Delete.
2004-06-27 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimplevelstool.c: removed two small chunks of code.
Fixes bug #141930. Possibly unfixes bug #132322.
2004-06-27 Michael Schumacher <schumaml@cvs.gnome.org>
* libgimp/gimp.def: added _gimp_tile_cache_flush_drawable because
it is used in a plug-in. See bug #145051.
2004-06-26 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/common/unsharp.c: Preview now works correctly with
RGBA and grayscale-alpha images. Fixes bug #144971.
2004-06-26 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpclonetool.c: added button_release callback
to fix bug #145022.
2004-06-26 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/common/unsharp.c: Use GTK_PREVIEW_GRAYSCALE if source
is grayscale or grayscale-alpha. Partial fix for bug #144971.
2004-06-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/unsharp.c: speed up preview by allocating tile
cache before creating dialog. Should fix bug #144972.
2004-06-25 Philip Lafleur <plafleur@cvs.gnome.org>
* plug-ins/common/zealouscrop.c: Moved Zealous Crop from
<Image>/Layer/Crop to <Image>/Image/Crop because it affects the
entire image.
2004-06-25 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/dog.c: added Difference of Gaussians edge
detect plug-in.
* plug-ins/common/plugin-defs.pl:
* plug-ins/common/Makefile.am: added dog and regenerated
Makefile.
2004-06-25 Michael Natterer <mitch@gimp.org>
* app/actions/context-actions.c: added GIMP_ACTION_SELECT_SET
actions which set a generated brush's properties directly.
* app/actions/context-commands.c: adjust the range of possible
brush radius and aspect_ratio values to be actually usable.
2004-06-25 Michael Natterer <mitch@gimp.org>
* app/core/gimpbrushgenerated.[ch]: reordered parameters and
members to be consistent with other places where generated
brushes are used. Check for errors when loading a brush and
utf8-validate its name. Cleanup.
* app/core/gimpbrush.c
* app/core/gimpbrushpipe.c: cleanup.
2004-06-25 Michael Natterer <mitch@gimp.org>
* app/gui/preferences-dialog.c (prefs_dialog_new): work around
GTK+ bug #143270 (set the cursor on the selected model path
instead of selecting the iter in the selection). Fixes random
theme switching when selecting the "Theme" page.
2004-06-25 Michael Natterer <mitch@gimp.org>
* app/core/gimpbrushgenerated.c: added properties for all brush
parameters.
* app/widgets/gimpbrusheditor.c: listen to property changes of the
edited brush and update the scales accordingly.
2004-06-25 Michael Natterer <mitch@gimp.org>
* app/gui/preferences-dialog.c: more work on the controller page,
made integer controller properties editable.
* modules/controller_midi.c: allow to specify the MIDI channel to
generate events from. Default to -1 (all channels).
2004-06-24 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/gfig/gfig.[ch]:
* plug-ins/gfig/gfig-preview.c: Let gfig use a thumbnail of the
image as background for its preview, if the image is RGB and "Show
image" is checked in the Options tab. (Next best thing to
previewing in the image.)
2004-06-25 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontrollerinfo.[ch]: added a boolean property
"debug-events" and honor it when printing debugging output.
Should add an event console window so the user doesn't need to
have a terminal to inspect input module output.
* app/gui/prefereces-dialog.c: HIGified some forgotten labels.
Renamed the "Pointer Movement Feedback" frame to "Mouse Cursors".
Replaced some forgotten "Dir" with "Folder".
Made more GimpControllerInfo and GimpController properties
editable and cleaned up the controller page.
2004-06-25 Michael Natterer <mitch@gimp.org>
* app/widgets/gimppropwidgets.[ch]: added gimp_prop_label_new().
* app/widgets/gimpgrideditor.c: HIGified capitalization.
2004-06-25 Michael Natterer <mitch@gimp.org>
* modules/controller_linux_input.c
* modules/controller_midi.c: remember the source ID returned by
g_io_add_watch() and remove it when changing the device, so the
file descritor gets actually closed. Minor cleanups.
2004-06-24 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontrollerwheel.[ch]: renamed function
gimp_controller_wheel_scrolled() to
gimp_controller_wheel_scroll().
* app/display/gimpdisplayshell-callbacks.c
(gimp_display_shell_canvas_tool_events): changed accordingly.
2004-06-24 Michael Natterer <mitch@gimp.org>
* etc/controllerrc: fix typo in wheel controller mapping.
2004-06-24 Michael Natterer <mitch@gimp.org>
* app/tools/gimptool.[ch]
* app/tools/tool_manager.[ch]: added boolean return value to
GimpTool::key_press() which indicates if the event was handled.
* app/tools/gimpcroptool.c
* app/tools/gimpeditselectiontool.[ch]
* app/tools/gimptransformtool.c
* app/tools/gimpvectortool.c: return TRUE if the key event was handled.
* app/tools/gimppainttool.c: removed key_press() implementation.
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpcontrollerkeyboard.[ch]: new controller class
which takes GdkEventKey and emits controller events for all
combinations of modifiers and cursor keys.
* app/widgets/gimpcontrollers.[ch]: added new function
gimp_controllers_get_keyboard().
* app/display/gimpdisplayshell-callbacks.c: if a key event was not
handled by the active tool, dispatch it to the keyboard controller.
* etc/controllerrc: add a keyboard controller which is configured
to do the same as the removed gimp_paint_tool_key_press().
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* libgimp/gimpdrawable.c: added some documentation for
a few important functions with no API docs.
2004-06-24 Sven Neumann <sven@gimp.org>
* Made 2.1.1 release.
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/actions/file-commands.c: make "Revert" only ask for
confirmation if image is dirty. Fixes bug #141971.
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/gui/*.c:
* app/widgets/*.c:
* etc/templaterc: HIGify capitalization. Should finish bug #123699
except for everything I missed or got wrong.
2004-06-24 Sven Neumann <sven@gimp.org>
* etc/controllerrc: commented out the linux_input controller
configuration.
2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/*.c: HIGify capitalization for dialogs. More
progress on bug #123699.
2004-06-23 Michael Natterer <mitch@gimp.org>
* modules/controller_midi.c: added utility function midi_event()
which assembles a GimpControllerEventValue and emits it.
2004-06-23 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpenumaction.[ch]
* app/widgets/gimppluginaction.[ch]
* app/widgets/gimpstringaction.[ch]: added parameters to the
gimp_*_action_selected() function so the "selected" signal can be
emitted with value != action->value. Changed GtkAction::activate()
implementations accordingly (pass action->value).
* app/widgets/gimpcontrollers.c: call gimp_enum_action_selected()
and pass the value of the GimpControllerEventValue instead of
temporarily replacing action->value and calling
gtk_action_activate().
* app/widgets/gimpcontrollerinfo.c: fixed debugging output.
2004-06-23 Michael Natterer <mitch@gimp.org>
* app/paint/gimpbrushcore.[ch]: added signal "set-brush" which is
G_SIGNAL_RUN_LAST so we can connect before and after the default
implementation. Moved the brush setting and outline invalidation
stuff to its default implementation. Also remember the outline's
width and height. Call gimp_brush_core_set_brush() from
gimp_brush_core_invalidate_cache() so "set-brush" is emitted
whenever a generated brush becomes dirty.
* app/tools/gimppainttool.c (gimp_paint_tool_button_press): don't
pause/resume but rather stop/start the draw_tool. Fixes straight
line preview aretefacts.
(gimp_paint_tool_oper_update): set the brush_core's brush before
starting the draw_tool.
(gimp_paint_tool_draw): never free the brush_core's cached brush
outline because the brush_core does that by itself now.
(gimp_paint_tool_set_brush)
(gimp_paint_tool_set_brush_after): new callbacks which pause and
resume the draw_tool. Fixes brush outline artefacts when modifying
the current brush e.g. by using the mouse wheel.
2004-06-23 Michael Natterer <mitch@gimp.org>
* app/actions/context-commands.h: removed enum GimpContextSelectType.
* app/actions/actions-types.h: added enum GimpActionSelectType.
* app/actions/actions.[ch]: added utility functions
action_select_value() and action_select_object().
* app/actions/context-actions.c
* app/actions/context-commands.c: changed accordingly.
* app/actions/layers-actions.c
* app/actions/layers-commands.[ch]: merged the layer select
callbacks into one using the GimpActionSelectType functions. Added
actions and callbacks for modifying the active layer's opacity.
* app/menus/menus-types.h: #incude "actions/action-types.h".
* app/gui/gui-types.h: #incude "menus/menus-types.h".
* app/gui/preferences-dialog.c: allow to enable/disable input
controllers.
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpcurvestool.c: try again to revert.
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpcurvestool.c: reverted.
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/script-fu/scripts: HIG-ified capitalization on
all. Finishes this for everything in plug-ins. Bug #123699 is
now mostly fixed.
2004-06-22 Sven Neumann <sven@gimp.org>
* app/composite/gimp-composite-regression.c: define timersub()
macro in case it's undefined. Patch by Tim Mooney, fixes 'make
check' on Tru64 (bug #144780).
2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpcurvestool.c: added Store/Recall buttons for
one-click saving and loading of curves. Should create stock
labels for them. Hopefully resolves bug #75558.
2004-06-22 Michael Natterer <mitch@gimp.org>
* app/actions/view-actions.c
* app/actions/view-commands.[ch]: added actions & callbacks to
configure the canvas padding color.
* app/widgets/gimphelp-ids.h
* menus/image-menu.xml.in: added the actions' help IDs and menu entries.
* app/display/display-enums.h: added /*< skip >*/'ed enum value
GIMP_CANVAS_PADDING_MODE_RESET.
* app/display/gimpdisplayshell-appearance.c
* app/display/gimpdisplayshell-callbacks.[ch]
* app/display/gimpdisplayshell-handlers.c
* app/display/gimpdisplayshell.[ch]: removed the canvas padding
button and its popup menu (fixes bug #142996). Instead, added a
toggle button which allows to zoom the image when the window is
resized (as known from sodipodi, except it doesn't work as nice
yet :-) improvements to the algorithm are welcome).
Cleaned up the GimpDisplayShell struct a bit and renamed some
of its members.
* libgimpwidgets/gimpstock.[ch]
* themes/Default/images/Makefile.am
* themes/Default/images/stock-zoom-follow-window-12.png: added new
icon for the new display toggle button.
2004-06-22 Michael Natterer <mitch@gimp.org>
* app/tools/gimpclonetool.c (gimp_clone_tool_draw): chain up
unconditionally now that we draw the brush outline while
painting. Fixes brush outline artefacts on button_press and
button_release. Spotted by sjburges.
2004-06-22 Sven Neumann <sven@gimp.org>
* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
the filename if the image is unnamed.
* configure.in
* app/sanity.c: depend on gtk+ >= 2.4.1.
* app/widgets/gimpthumbbox.[ch]: changed gimp_thumb_box_set_uris()
to gimp_thumb_box_take_uris() since the function takes ownership
of the list,
* app/widgets/gimpfiledialog.c: changed accordingly. Removed code
that worked around a problem in gtk+ < 2.4.1.
2004-06-22 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpcolorarea.c (gimp_color_area_set_color): use
gimp_rgb_distance() for flat color areas. Fixes bug #144786.
2004-06-22 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/fileops.pdb: app/pdb/fileops_cmds.c is a
generated file, need to do the documentation change here.
* app/pdb/fileops_cmds.c
* libgimp/gimpfileops_pdb.c: regenerated.
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimptransformoptions.c: use radio buttons
for constraint options. Makes all options visible,
should resolve bug #68106.
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/gui/file-save-dialog.c: to reduce clutter, hide overwrite
query dialog after user has responded.
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/noisify.c: changed handling of alpha
channel in an attempt to deal with bug #72853.
Changed menu entry from "Noisify" to "Scatter RGB".
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/pdb/fileops_cmds.c: fixed incorrect documentation for
gimp_file_load, which was the root cause of bug #118811.
2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins: finish implementing HIG capitalization in dialogs.
Scripts remain to be done. More progress on bug #123699.
2004-06-21 Michael Natterer <mitch@gimp.org>
* app/widgets/widgets-enums.[ch] (enum GimpCursorFormat): removed
value GIMP_CURSOR_FORMAT_PIXBUF_PREMULTIPLY because it's the job
of GDK to do that (it was GDK that was broken, not some of the X
servers).
* app/widgets/gimpcursor.c (gimp_cursor_new): premultiply the
cursor's pixels for GTK+ < 2.4.4.
2004-06-21 Sven Neumann <sven@gimp.org>
* app/gui/gui.c (gui_exit_callback): improved message in quit
dialog just in case that we don't manage to redo this dialog
before 2.2.
2004-06-21 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpwidgets.[ch]
* libgimpwidgets/gimpwidgets.def: added new utility function
gimp_label_set_attributes().
* app/display/gimpdisplayshell.c
* app/gui/preferences-dialog.c
* app/gui/resolution-calibrate-dialog.c
* app/widgets/gimpviewabledialog.c
* app/widgets/gimpwidgets-utils.c: use the new function.
* app/widgets/gimpcontainergridview.c
* app/widgets/gimphistogrameditor.c: display the name in italic.
* plug-ins/common/jpeg.c: display the file size in italic.
2004-06-20 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/url.c: if url does not end in a recognized
extension, open it as an unnamed image. Fixes bug #118811.
2004-06-20 Sven Neumann <sven@gimp.org>
* app/widgets/gimphistogrambox.[ch]: removed the label between the
spinbuttons, it looks silly. Converted tabs to spaces, removed
trailing whitespace.
* app/widgets/gimphistogrameditor.c
* app/tools/gimpthresholdtool.c: changed accordingly.
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins: changed dialogs to follow HIG capitalization style
wherever they didn't. Scripts remain to be done. Partially
fixes bug #123699.
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/widgets/gimphistogrambox.[ch]:
* app/tools/gimpthresholdtool.c: Changed the threshold tool dialog
so that it uses a two-triangle-slider scale of the sort used in the
levels tool. Almost all of the changes are actually in the
histogram-box widget code, which is only used by the threshold
tool. Fixes bug #137521.
2004-06-20 Sven Neumann <sven@gimp.org>
* plug-ins/common/jpeg.c: removed redundant hboxes and other
layout cleanups.
2004-06-20 Philip Lafleur <plafleur@cvs.gnome.org>
* app/display/gimpdisplayshell-scale.[ch]:
* app/display/gimpnavigationview.[ch]:
* app/actions/view-actions.c:
* app/actions/view-commands.[ch]:
* app/widgets/gimphelp-ids.h:
* menus/image-menu.xml.in: Changed "Zoom to Fit Window" command
to "Fit Image in Window" and added another command, "Fit Image
to Window", that zooms according to the opposite dimension. Fixes
bug #144597.
2004-06-19 Michael Schumacher <schumaml@cvs.gnome.org>
* libgimpwidgets/gimpwidgets.def: added missing
gimp_controller_* entries
2004-06-19 Michael Schumacher <schumaml@cvs.gnome.org>
* modules/controller_midi.c: #ifdef G_OS_WIN32 for an O_NONBLOCK
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/jpeg.c: more changes to save dialog. Moved
comment field to Advanced area. Don't set restart marker
frequency stuff insensitive. Changed range for quality
scale from 0-1 to 0-100 to follow the jpeg spec (but left
allowable range for pdb at 0-1 to avoid breaking anything).
2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpscaletool.c: fixed my fix for bug # 68106, which
worked incorrectly for two of the control points.
2004-06-19 Michael Natterer <mitch@gimp.org>
* modules/controller_midi.c (midi_read_event): simplified
swallowing of SysEx messages and unwanted data bytes. Reordered
and commented stuff to be more readable.
2004-06-19 Michael Natterer <mitch@gimp.org>
* modules/Makefile.am
* modules/controller_midi.c: new controller for MIDI input. Maps
all note on and note off events and all MIDI controllers to
GimpContollerEvents. Should parse any MIDI stream. Code based on
blinkenmedia stuff from Daniel Mack.
2004-06-19 Sven Neumann <sven@gimp.org>
Applied a patch from Geert Jordaens that implements the
GtkStatusbar functionality in GimpStatusbar so that we can redo it
in order to fix bug #120175:
* app/core/gimpmarshal.list: added VOID: UINT, STRING.
* app/display/gimpstatusbar.[ch]: copied GtkStatusbar code.
* app/display/gimpdisplayshell.c: changed accordingly.
2004-06-19 Sven Neumann <sven@gimp.org>
* plug-ins/ifscompose/ifscompose_utils.c (create_brush): use
G_SQRT2; some coding style cleanups.
2004-06-19 Sven Neumann <sven@gimp.org>
* app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): moved
array initialization out of variable declaration (bug #144632).
2004-06-19 Sven Neumann <sven@gimp.org>
* app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): use
G_SQRT2 to make circlemagic a constant value so we can initialize
the array on declaration. Fixes bug #144632.
2004-06-19 Sven Neumann <sven@gimp.org>
* devel-docs/parasites.txt: document "exif-data" parasite.
2004-06-18 Manish Singh <yosh@gimp.org>
* plug-ins/common/film.c: Don't use deprecated gimp_text functions,
clean up font name string handling a bit, default is now "Monospace"
instead of "Courier".
2004-06-19 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
start supporting GIMP_CONTROLLER_EVENT_VALUE of type gdouble.
Assume the double value is in a [0.0..1.0] range and temporarily
change the value of the called GimpEnumAction to a range of
[0..1000] when invoking it. All still very hackish...
2004-06-19 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontrollerinfo.c (gimp_controller_info_event):
more debugging output.
2004-06-18 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* app/tools/gimpscaletool.c: changed algorithm for scaling when
aspect ratio is constrained, to fix strange behavior described
in bug # 68106.
2004-06-18 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/jpeg.c: redid save dialog along lines suggested
in bug # 138929
Only create an exif data parasite on loading file if the file actually
contains exif data.
Call exif data parasite "exif-data" instead of "jpeg-exif-data",
because it should be interchangeable with TIFF exif data.
2004-06-18 Michael Natterer <mitch@gimp.org>
* app/actions/context-actions.c
* app/actions/context-commands.[ch]: added tons of new actions to
modify the current FG/BG color's RGB components.
Added new enum value GIMP_CONTEXT_SELECT_SET which allows to set
values, not only increase/decrease them.
Changed context_select_value() utility function to interpret
GimpEnumAction::value being >= GIMP_CONTEXT_SELECT_SET as settings
in a range from 0 to 1000. Yes, that's a hack...
2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org>
* app/tools/gimptransformtool.c: reverted my fix to bug #144570.
2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org>
* app/tools/gimpfuzzyselecttool.c: Fix fuzzy select menu label.
2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org>
* app/tools/gimptransformtool.c (gimp_transform_tool_bounds):
If transforming a path, use the path bounds rather than the mask
bounds. Fixes bug #144570.
2004-06-17 Michael Natterer <mitch@gimp.org>
* app/core/gimp-utils.[ch]: added gimp_boolean_handled_accum().
* app/core/gimp.c
* app/widgets/gimpcontrollerinfo.c: use it.
2004-06-17 Michael Natterer <mitch@gimp.org>
* app/core/gimpcontainer.c (gimp_container_deserialize): add newly
created children to the container *after* deserializing them so
GimpContainer::add() callbacks get the already deserialized
object.
* app/widgets/gimpcontrollers.c: connect to "add" and "remove" of
the controller list and remember / clear the wheel controller when
it appears / disappears.
2004-06-17 Sven Neumann <sven@gimp.org>
* autogen.sh: check for xsltproc and mention that the intltool
version mismatch is harmless.
2004-06-17 Pedro Gimeno <pggimeno@wanadoo.es>
* tools/pdbgen/pdb/paths.pdb: Fix typos and improve documentation.
Addresses bug #144267.
* app/pdb/paths_cmds.c
* libgimp/gimppaths_pdb.c: regenerated.
2004-06-17 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcontroller.[ch]: removed "enabled"
property. Removed GIMP_CONTROLLER_PARAM_SERIALIZE from the "name"
property because it's the hardware-determined name of this
controller instance.
* app/widgets/gimpcontrollerwheel.c
* modules/controller_linux_input.c: set the name.
* libgimpwidgets/gimpwidgets.h: #include gimpcontroller.h.
* app/widgets/gimpcontrollerinfo.[ch]: added "enabled" here
instead. Don't dispatch events if the controller is
disabled. Made everything work (not crash) with info->mapping
being NULL.
* etc/controllerrc: updated again with the changed format.
* app/widgets/gimpcontrollers.[ch]: added
gimp_controllers_get_list() which returns the container of
controllers.
* app/widgets/gimphelp-ids.h
* app/gui/preferences-dialog.c: added controller configuration
(can't change anything yet, just view the current settings).
Resurrected the "Input Devices" page and removed the "Session"
page by moving its widgets to other pages. Pack the various
"Save now"/"Clear now" buttons vertically, not horizontally.
Fixes bug #139069.
* themes/Default/images/preferences/Makefile.am
* themes/Default/images/preferences/controllers.png
* themes/Default/images/preferences/theme.png: new icons for new
prefs pages. Someone needs to make them nice...
2004-06-17 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell.c: GtkUIManager makes the menu bar
visible by default, hide it if options->show_menubar is FALSE.
Fixes bug #143243.
2004-06-17 Sven Neumann <sven@gimp.org>
* configure.in: bumped version to 2.1.1. Allow to disable the
build of the linux_input controller module.
2004-06-17 Philip Lafleur <plafleur@cvs.gnome.org>
* app/core/gimpdrawable-transform.c
(gimp_drawable_transform_tiles_affine): Make transforms (most
notably perspective transforms) conform exactly to specified
edges. Includes a patch by David Gowers. Fixes bug #144352.
2004-06-16 Manish Singh <yosh@gimp.org>
* modules/controller_linux_input.c: put BTN_{WHEEL,GEAR_DOWN,GEAR_UP}
usage in #ifdefs, since pre-2.6 kernels do not have them.
* modules/controller_linux_input.c (linux_input_read_event): n_bytes
should be a gsize.
2004-06-16 Michael Natterer <mitch@gimp.org>
* app/actions/context-actions.c
* app/actions/context-commands.[ch]: added actions & callback
to select the first/last/prev/next tool.
2004-06-16 Simon Budig <simon@gimp.org>
* modules/controller_linux_input.c: removed BTN_MISC,
since it is the same as BTN_0 in the input.h header file.
2004-06-16 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcontroller.c (gimp_controller_get_event_name)
(gimp_controller_get_event_blurb): always return a non-NULL
string (return "<invalid event id>" as fallback).
* modules/controller_linux_input.c: reenabled button event
dispatching.
* app/widgets/gimpcontrollerinfo.c: fixed debugging output.
2004-06-16 Simon Budig <simon@gimp.org>
* modules/controller_linux_input.c: break out of the
loop after we handled the first matching rel_event.
2004-06-16 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcontroller.[ch]: added #define
GIMP_CONTROLLER_PARAM_SERIALIZE. Made all properties serializable.
* modules/controller_linux_input.c: made "device-name"
serializable.
* app/config/gimpconfig-params.h: added macro
GIMP_CONFIG_INSTALL_PROP_POINTER() which needs to be handled
by custom (de)serialize_property() implementations.
* app/config/gimpconfig-deserialize.c
* app/config/gimpconfig-serialize.c: made object (de)serialization
work for object properties which are *not* GIMP_PARAM_AGGREGATE.
Write/parse the exact type of the object to create to enable this.
* app/core/gimpmarshal.list: new marshaller for GimpControllerInfo.
* app/widgets/gimpcontrollerinfo.[ch]: implement GimpConfigInterface
and add "controller" and "mapping" properties. Add "event-mapped"
signal which carries the action_name.
* app/widgets/gimpcontrollers.c: removed all deserialization code
and simply (de)serialize the controller container. Install a
container handler for "event-mapped" and do the action_name ->
action mapping in the callback.
* etc/controllerrc: regenerated with new syntax. Delete your old one!
2004-06-16 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcontrollerwheel.c
(gimp_controller_wheel_get_event_name): don't use gettext() here.
* modules/controller_linux_input.c: added more button events, set
the device name, some cleanup.
2004-06-16 Sven Neumann <sven@gimp.org>
* plug-ins/common/plugin-defs.pl: changed dependencies for blur.
* plug-ins/common/Makefile.am: regenerated.
* plug-ins/common/blur.c: no need to include libgimpui.h any longer.
2004-06-16 Bill Skaggs <weskaggs@primate.ucdavis.edu>
* plug-ins/common/blur.c: removed randomize and repeat options;
made to run without popping a dialog. (bug #142318)
2004-06-16 Simon Budig <simon@gimp.org>
* modules/controller_linux_input.c: enable dial-events for
e.g. the powermate. Fixed typo.
2004-06-16 Sven Neumann <sven@gimp.org>
* menus/image-menu.xml.in: added missing menu entries (bug #144449).
2004-06-16 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcontroller.[ch]: added
GimpController::get_event_blurb() which returns the strings that
were returned by get_event_name(). The latter returns
untranslatable event identifiers now.
* app/widgets/gimpcontrollerwheel.c
* modules/controller_linux_input.c: changed accordingly.
* app/widgets/gimpcontrollerinfo.c
* app/widgets/gimpcontrollers.c: changed the event mapping from
event-id -> action-name to event-name -> action-name.
* etc/controllerrc: changed accordingly (finally readable now).
2004-06-16 Michael Natterer <mitch@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpcontrollerinfo.[ch]: made an object out of
the GimpControllerInfo struct.
* app/widgets/gimpcontrollers.c: changed accordingly.
2004-06-16 Jakub Steiner <jimmac@ximian.com>
* etc/controllerrc: fix typo
2004-06-16 Sven Neumann <sven@gimp.org>
* modules/controller_linux_input.c
* etc/controllerrc: preliminary wheel event support.
2004-06-16 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontrollers.c: better debugging output.
2004-06-16 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcontrollers.c: bug fix.
* configure.in: check for linux/input.h.
* modules/Makefile.am
* modules/controller_linux_input.c: added a prototype controller
module using the linux input event interface.
* etc/controllerrc: added example config for linux input device.
2004-06-16 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontrollers.c: load the controller's
properties from the controllerrc file.
* etc/controllerrc: set the wheel's properties.
2004-06-16 Michael Natterer <mitch@gimp.org>
* etc/controllerrc: use the 10% actions for opacity.
2004-06-16 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontrollers.c: ref the actions when putting
them in the mapping table.
* app/actions/context-actions.c: added actions to change the
opacity in 10% steps.
2004-06-16 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcontroller.[ch]: added a "name" property.
Dispatch events only if the controller is enabled.
* app/widgets/gimpcontrollerwheel.c: added controller events for
all possible modifier combinations.
* etc/Makefile.am
* etc/controllerrc: default controllerrc which maps all unused
wheel+modifier combinations to more-or-less usefull stuff.
2004-06-16 Michael Natterer <mitch@gimp.org>
Started to fix bug #106920 in a more genreral way:
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpwidgetstypes.h
* libgimpwidgets/gimpwidgetsmarshal.list
* libgimpwidgets/gimpcontroller.[ch]: new abstract base class
which provides an API for pluggable input controller modules
(mouse wheel, usb/midi stuff etc.).
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpcontrollerwheel.[ch]: subclass of the above
which maps wheel mouse scroll events to controller events.
* app/widgets/gimpcontrollers.[ch]: manager for controllers.
reads $(gimpdir)/controllerrc and keeps a mapping of controller
events to GtkActions.
* app/gui/gui.c: initialize and shut down the controller stuff.
* app/display/gimpdisplayshell-callbacks.c
(gimp_display_shell_canvas_tool_events): if a wheel controller
exists, dispatch GdkEventScroll to it first and return if it was
handled.
2004-06-15 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/text_tool.pdb: deprecate the XLFD-based API
gimp_text() and gimp_text_get_extents().
* app/pdb/text_tool_cmds.c
* libgimp/gimptexttool_pdb.[ch]: regenerated.
2004-06-15 Manish Singh <yosh@gimp.org>
* tools/pdbgen/pdbgen.pl
* tools/pdbgen/lib.pl: some simplistic code to add a $deprecated
flag to pdb definitions, which translates into GIMP_DISABLE_DEPRECATED
guards in lib headers.
2004-06-15 Michael Natterer <mitch@gimp.org>
* app/actions/Makefile.am
* app/actions/context-actions.[ch]
* app/actions/context-commands.[ch]: added new action group to
modify all GimpContext properties. So far there are actions to
cycle through the lists of brushes, patterns etc., to change the
opacity, to swap and default colors and to edit generated brushes.
* app/actions/actions.c: register the new "context" action group.
* app/actions/tools-actions.c
* app/actions/tools-commands.[ch]: removed "tools-default-colors"
and "tools-swap-colors" actions and callbacks because they are
in the "context" action group now.
* app/menus/menus.c: add the "context" group to the <Image> and
<Dock> UI managers.
* menus/image-menu.xml.in: changed accordingly. Added a temporary
"Context" menu to test and debug the new actions.
2004-06-15 Philip Lafleur <plafleur@cvs.gnome.org>
* app/tools/gimpcroptool.c (crop_selection_callback): Force
aspect ratio to match selection when 'From Selection' is clicked.
Fixes bug #144361. Also converted tabs to spaces.
2004-06-15 Sven Neumann <sven@gimp.org>
* plug-ins/common/mng.c (respin_cmap): applied the fix for empty
colormaps (bug #143009) here as well.
2004-06-15 Philip Lafleur <plafleur@cvs.gnome.org>
* app/core/gimpdrawable-transform.c
(gimp_drawable_transform_tiles_affine): Don't round texture
coordinates when not using interpolation. Fixes bug #144352 for
the nearest neighbor case only.
2004-06-14 Sven Neumann <sven@gimp.org>
* app/paint/gimpinkoptions.c: replaced some arbitrary values with
larger but still arbitrary values (default and limit for ink size).
2004-06-14 Michael Natterer <mitch@gimp.org>
* app/paint/gimppaintcore.[ch]: removed PRETRACE_PAINT and
POSTTRACE_PAINT from the GimpPaintCoreState enum. Removed
"gboolean traces_on_window" from GimpPaintCoreClass.
* app/paint/gimpclone.[ch]
* app/paint/gimpink.c
* app/tools/gimpclonetool.c: changed accordingly.
* app/tools/gimppainttool.c: ditto. Show the brush outline
while painting. Fixes bug #118348.
2004-06-14 Michael Natterer <mitch@gimp.org>
* app/tools/gimptransformtool.c: use gimp_draw_tool_is_active()
instead of GIMP_IS_DISPLAY(draw_tool->gdisp).
2004-06-14 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions):
do the workaround for "" accelerators only if the GTK+ version
is smaller than 2.4.3. Fixes bug #144342 for GTK+ >= 2.4.3.
2004-06-14 Sven Neumann <sven@gimp.org>
* app/core/gimpdrawable-transform.c: declared
gimp_drawable_transform_cubic() as inline function. Makes
sample_cubic() run about 10% faster and causes a 7% speedup on
cubic transformations.
* app/paint-funcs/paint-funcs.c (border_region): avoid an
unnecessary memory allocation.
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
* app/tools/gimptransformtool.c: Disable preview in corrective
mode, and notify preview when switching transform type and
direction.
2004-06-14 Michael Natterer <mitch@gimp.org>
* app/paint/gimppaintcore.[ch]: added new virtual function
GimpPaintCore::post_paint() and call it after calling
GimpPaintCore::paint().
* app/paint/gimpbrushcore.[ch]: renamed brush_core->grr_brush
to brush_core->main_brush and reset brush_core->brush
to brush_core->main_brush in GimpPaintCore::post_paint().
* app/paint/gimpbrushcore.c
* app/paint/gimppaintcore-stroke.c
* app/tools/gimppainttool.c: removed all code which restores
the brush_core's old brush after painting since post_paint()
does this automatically now.
* app/paint/gimpclone.[ch]: moved static variables to the
GimpClone struct.
2004-06-14 Sven Neumann <sven@gimp.org>
* app/paint-funcs/paint-funcs-generic.h (color_pixels): some code
cleanup I did while attempting to optimize this code further.
2004-06-14 Henrik Brix Andersen <brix@gimp.org>
* app/plug-in/plug-in-run.c: let extensions run synchronously when
called via PDB. Fixes bug #140112.
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
* app/tools/gimptransformtool.c: Preview is now only used for
layer transformations.
2004-06-14 Michael Natterer <mitch@gimp.org>
* app/tools/gimpperspectivetool.c
* app/tools/gimprotatetool.c
* app/tools/gimpscaletool.c
* app/tools/gimpsheartool.c: removed calls to
gimp_transform_tool_expose_preview() from all
GimpTransformTool::motion() implementations...
* app/tools/gimptransformtool.c: ...and call it after calling
tr_tool_class->preview().
2004-06-14 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell.[ch]: remember the last used
GimpCursorFormat so changing the format in prefs applies
instantly, and not after the next tool change.
* app/display/gimpdisplayshell-cursor.[ch]
* app/tools/gimptool.[ch]
* app/tools/gimptoolcontrol.[ch]
* app/tools/gimpclonetool.c
* app/tools/gimpcolortool.c
* app/tools/gimpcroptool.c
* app/tools/gimpcurvestool.c
* app/tools/gimpiscissorstool.c
* app/tools/gimpmeasuretool.c
* app/tools/gimpmovetool.c
* app/tools/gimptransformtool.c: s/GdkCursorType/GimpCursorType/g
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
* app/tools/gimptransformtool.c (gimp_transform_tool_doit): Preview
wasn't being turned off before performing a transformation. Also
converted tabs to spaces.
2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org>
* app/display/gimpdisplayshell-preview.c: Transformation previews now
use the selection mask if it is present.
2004-06-13 Manish Singh <yosh@gimp.org>
* configure.in: Make sure PangoFT2 is using a recent enough fontconfig
since many people have broken and confused setups.
2004-06-13 Manish Singh <yosh@gimp.org>
* tools/pdbgen/pdb/gradient_edit.pdb: cleans ups so generated
output doesn't warn about uninitialize variable use, and whitespace
cosmetic cleanups.
* app/pdb/gradient_edit_cmds.c: regenerated.
2004-06-13 Manish Singh <yosh@gimp.org>
* app/base/cpu-accel.c: Reorged, to address bug #142907 and
bug #143069. Accel implementations #define HAVE_ACCEL, and cpu_accel()
keys on that. Both PPC and X86 implementations check for __GNUC__.
X86 stuff is only used with USE_MMX is defined. The SSE OS check
is now checked in arch_accel(), not cpu_accel(). Finally, the
arch x86_64 checks now are EM64T aware (which didn't matter in
practice).
2004-06-13 Philip Lafleur <plafleur@cvs.gnome.org>
* app/display/gimpdisplayshell-preview.c: use drawable_mask_bounds()
for texture coordinates instead of the drawable's width and height.
2004-06-13 Sven Neumann <sven@gimp.org>
* app/paint-funcs/paint-funcs.c (shapeburst_region): don't call
tile_ewidth() three times from the inner loop.
* app/base/tile-manager.c (tile_manager_get): don't call
tile_size() twice on the same tile.
* app/base/tile-private.h: added tile_size_inline(), an inline
version of the tile_size() function.
* app/base/tile-cache.c
* app/base/tile-manager.c
* app/base/tile-swap.c
* app/base/tile.c: use tile_size_inline() from inside the tile
subsystem.
2004-06-13 Simon Budig <simon@gimp.org>
* app/tools/gimpiscissorstool.c: Minor tweaks to two macros.
Shouldn't change anything.
2004-06-13 Jakub Steiner <jimmac@ximian.com>
* cursors/tool-zoom.png:
* cursors/cursor-zoom.png: minor fsckup
2004-06-13 Jakub Steiner <jimmac@ximian.com>
* cursors/gimp-tool-cursors.xcf
* cursors/tool-burn.png: the burn tool doesn't really have an
inverted handle
2004-06-13 Sven Neumann <sven@gimp.org>
* app/paint-funcs/paint-funcs.[ch] (shapeburst_region): added
progress callback.
* app/core/gimpdrawable-blend.c: show a progress while calculating
the Shapeburst. Not perfect but better than not showing any
progress at all.
2004-06-13 Michael Natterer <mitch@gimp.org>
* app/widgets/widgets-enums.[ch]: added enum GimpCursorFormat
which can be one of { BITMAP, PIXBUF, PIXBUF-PREMULTIPLY } to
work around broken X servers.
* app/config/gimpguiconfig.[ch]
* app/config/gimprc-blurbs.h: added GimpGuiConfig::cursor-format.
* app/gui/preferences-dialog.c: added a GUI for the new option.
* app/widgets/gimpcursor.[ch]: added cursor_format parameter
to gimp_cursor_new() and _set().
* app/display/gimpdisplayshell-cursor.c
* app/tools/gimpcurvestool.c
* app/widgets/gimpdialogfactory.c: pass an appropriate cursor_mode.
2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org>
* app/core/gimpdrawable-blend.c: added missing semicolon.
2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org>
* app/display/gimpdisplayshell-callbacks.c: Fixed incorrect logic that
caused perfect-but-slow pointer tracking to be used in tools that
don't request exact mode.
* app/display/Makefile.am:
* app/display/gimpdisplayshell-appearance.[ch]:
* app/display/gimpdisplayshell-callbacks.c:
* app/display/gimpdisplayshell.[ch]:
* app/display/gimpdisplayshell-preview.[ch]: added
* app/tools/gimpperspectivetool.c:
* app/tools/gimprotatetool.c:
* app/tools/gimpscaletool.c:
* app/tools/gimpsheartool.c:
* app/tools/gimptransformoptions.[ch]:
* app/tools/gimptransformtool.[ch]: Implemented live transformation
previews, available through tool options. Fixes bug #108172.
2004-06-13 Sven Neumann <sven@gimp.org>
* app/core/gimpdrawable-blend.c (gradient_render_pixel): inline
the repeat functions.
* app/core/gimpgradient.c: inline the curve functions.
2004-06-13 Jakub Steiner <jimmac@ximian.com>
* cursors/gimp-tool-cursors.xcf
* cursors/tool-zoom.png: make more transparent
2004-06-13 Jakub Steiner <jimmac@ximian.com>
* cursors/gimp-tool-cursors.xcf
* cursors/tool-blur.png
* cursors/tool-bucket-fill.png
* cursors/tool-dodge.png
* cursors/tool-eraser.png
* cursors/tool-hand.png: fix a few problems hidden by low opacity
2004-06-13 Jakub Steiner <jimmac@ximian.com>
* cursor/*png: updated the cursors
2004-06-13 Michael Natterer <mitch@gimp.org>
* cursors/gimp-tool-cursors.xcf: added nice new antialiased
cursor layers made by Jimmac.
2004-06-13 Sven Neumann <sven@gimp.org>
* app/core/gimppalette.c (gimp_palette_load): don't use the rather
inefficient gimp_palette_add_entry() when loading a palette.
2004-06-13 Michael Natterer <mitch@gimp.org>
* app/core/gimpdata.[ch]: added "gint freeze_count" and
gimp_data_freeze()/thaw() functions. Emit "dirty" only if
freeze_count either is 0 or drops to 0.
* app/core/gimpbrushgenerated.[ch]
* app/core/gimpgradient.[ch]: removed freeze/thaw stuff that
was duplicated in these two subclasses and use the new
GimpData API instead.
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpgradienteditor.c: changed accordingly.
2004-06-12 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcolorbar.c (gimp_color_bar_expose): don't copy
the first row onto itself.
2004-06-12 Simon Budig <simon@gimp.org>
* app/tools/gimptransformtool.c: Make Enter/Return apply the
transformation, Backspace/Delete resets the transformation.
* app/tools/gimpcroptool.c: Simplify the key_press callback.
2004-06-12 Simon Budig <simon@gimp.org>
* app/tools/gimpcroptool.c: Make the Enter/Return key do
the crop action.
* app/tools/gimpeditselectiontool.c
* app/tools/gimpvectortool.c: Make the _key_press functions
safe for non-arrow keys.
2004-06-12 Sven Neumann <sven@gimp.org>
* app/composite/gimp-composite.[ch]: just some cleanup.
2004-06-12 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell-callbacks.c
(gimp_display_shell_events): ported some forgotten #if 0'ed
GtkItemFactory stuff to GtkUIManager.
2004-06-12 Simon Budig <simon@gimp.org>
* app/tools/gimptool.[ch]: renamed the "arrow_key" member
to "key_press", since it is now no longer about just the arrow
keys.
* app/tools/gimpcroptool.c
* app/tools/gimpeditselectiontool.c
* app/tools/gimpeditselectiontool.h
* app/tools/gimpmovetool.c
* app/tools/gimppainttool.c
* app/tools/gimpselectiontool.c
* app/tools/gimptexttool.c
* app/tools/gimpvectortool.c
* app/tools/tool_manager.c: Changed accordingly.
2004-06-12 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell.c (gimp_display_shell_init): add
the file DND destination before all others so the DND code will
implicitly use its destination properties. Works around Konqueror
offering only file MOVE, not COPY and fixes bug #144168.
2004-06-12 Sven Neumann <sven@gimp.org>
* plug-ins/common/sample_colorize.c: reindented, some minor cleanup.
2004-06-12 Simon Budig <simon@gimp.org>
* app/tools/tool_manager.[ch]: renamed
tool_manager_arrow_key_active to tool_manager_key_press_active.
* app/display/gimpdisplayshell-callbacks.c: Also dispatch
GDK_Return/KP_Enter/BackSpace/Delete to the tools, the
"arrow_key" member of GimpTool probably should be renamed.
* app/tools/gimpvectortool.c: Use Enter/Return to convert the
current path to a selection, use Backspace/Delete to delete the
currently active anchors in a path.
Implemented on Jimmacs request - thanks to him and Iva for being
a great host :)
2004-06-12 Sven Neumann <sven@gimp.org>
* app/widgets/gimphistogrameditor.c (gimp_histogram_editor_init):
set the initially selected channel on the histogram combobox.
Fixes bug #144225.
2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org>
* app/paint/gimppaintoptions.[ch]: renamed all "pressure-pressure"
variables to "pressure-hardness".
* app/paint/gimpairbrush.c:
* app/tools/gimppaintoptions-gui.c: changed accordingly.
2004-06-10 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpcolorarea.c: replaced destroy() by
finalize(), converted tabs to spaces, cleanup.
2004-06-10 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): line-wrap the
filename label if it's too long instead of cutting it off.
2004-06-10 Michael Natterer <mitch@gimp.org>
* app/widgets/widgets-enums.h (enum GimpCursorModifier):
s/GIMP_LAST_CURSOR_MODIFIER_ENTRY/GIMP_CURSOR_MODIFIER_LAST/.
* app/widgets/gimpcursor.c: changed accordingly. Renamed struct
GimpBitmapCursor to GimpCursor. More cleanup.
2004-06-10 Michael Natterer <mitch@gimp.org>
* app/actions/image-actions.c
* app/actions/image-commands.[ch]
* app/actions/layers-actions.c
* app/actions/layers-commands.[ch]: made the
"image-convert-rgb/grayscale/indexed" and the
"layers-mask-apply/delete" actions GimpEnumActions and merged
their callbacks.
2004-06-10 Philip Lafleur <plafleur@cvs.gnome.org>
* app/gui/preferences-dialog.c: restored the 'Show Paint Tool
Cursor' option that was removed during clean-up.
2004-06-10 Philip Lafleur <plafleur@cvs.gnome.org>
* app/paint/gimpbrushcore.c (gimp_brush_core_pressurize_mask):
avoided some redundant calculations.
2004-06-10 Sven Neumann <sven@gimp.org>
* app/gui/user-install-dialog.c: removed the monitor calibration
from the user installation process. It's not a vital setting and
can be done from the Preferences dialog later.
* app/gui/resolution-calibrate-dialog.[ch]: simplified the
resolution calibration dialog by removing the hacks that were
needed for drawing it in the user-installation style.
* app/gui/preferences-dialog.c: changed accordingly. Also removed
the separator from the Display page.
2004-06-10 Sven Neumann <sven@gimp.org>
* app/widgets/gimptemplateeditor.[ch]: added an API to
expand/collapse the "Advanced Options" frame.
* app/gui/preferences-dialog.c
* app/widgets/gimphelp-ids.h: applied a patch done by William
Skaggs that cleans up and reorganizes the Preferences dialog
(bug #144060).
2004-06-09 Simon Budig <simon@gimp.org>
* app/core/gimpcoords.[ch]: renamed gimp_coords_length2 to
gimp_coords_length_squared.
* app/vectors/gimpbezierstroke.c: Changed accordingly
2004-06-09 Sven Neumann <sven@gimp.org>
* app/tools/gimppenciltool.c (gimp_pencil_tool_init): no need to
request GIMP_MOTION_MODE_EXACT here since the parent class does
that already.
* app/tools/gimpinktool.c (gimp_ink_tool_init): ditto. Enable the
color picker feature for the ink tool.
2004-06-09 Sven Neumann <sven@gimp.org>
* menus/image-menu.xml.in: added "Selection Editor" to the
Selection menu. Still hoping for the great menu reorganization
though...
* app/actions/select-actions.c (select_actions_update): "Save to
Channel" makes sense without a selection also, so don't set it
insensitive.
2004-06-07 Sven Neumann <sven@gimp.org>
* plug-ins/common/glob.c: the glob(3) function is not available on
Win32 and also isn't necessarily UTF-8 safe. Started to add an
alternative implementation. Right now there's just some code taken
from GTK+ (an UTF-8 save fnmatch() implementation) and the plug-in
does nothing useful. I will add some stripped-down glob code based
on the code in glibc later.
2004-06-07 Michael Natterer <mitch@gimp.org>
* app/core/gimplayer.c (gimp_layer_set_tiles): don't set
layer->mask's offsets. It is wrong because GimpDrawable::set_tiles()
is a lowlevel function which is used by stuff like scale and
resize which keep the mask in sync explicitely and don't expect it
to be moved in the middle of chaining up. Fixes bug #143860.
2004-06-07 Michael Natterer <mitch@gimp.org>
* app/actions/view-actions.c
* app/actions/view-commands.[ch]: added separate callback for
"view-zoom-other" and connect GtkAction::activate manually so
"Other..." can be selected even if it's the active item in the
zoom radio group. Fixes bug #143850.
2004-06-07 Sven Neumann <sven@gimp.org>
* plug-ins/common/tileit.c (tileit_dialog): fixed a typo.
2004-06-07 Sven Neumann <sven@gimp.org>
* app/menus/plug-in-menus.c (plug_in_menus_setup): sort the menus
by the translated menu path stripped from underscores.
2004-06-06 Sven Neumann <sven@gimp.org>
* plug-ins/common/gauss.c (gauss): fixed a stupid cut'n'paste bug
I introduced yesterday.
2004-06-06 Sven Neumann <sven@gimp.org>
* plug-ins/common/gauss.c (query): register the menu entry the new
way and install a mnemonic for Gaussian Blur.
2004-06-05 Sven Neumann <sven@gimp.org>
* plug-ins/common/curve_bend.c: applied a patch from Henrik Brix
Andersen that tells the user that Curve Bend cannot operate on
layers with masks instead of silently applying the mask
(bug #134748).
2004-06-05 Sven Neumann <sven@gimp.org>
* plug-ins/common/plugin-defs.pl
* plug-ins/common/Makefile.am
* plug-ins/common/gauss_iir.c
* plug-ins/common/gauss_rle.c: removed the two gaussian blur
plug-ins...
* plug-ins/common/gauss.c: and added a merged version done by
William Skaggs. Fixes bug #134088.
2004-06-05 Sven Neumann <sven@gimp.org>
* plug-ins/sgi/sgi.c: applied a patch from Philip Lafleur that
makes the plug-in handle images with more than 4 channels. At the
moment the extra information is discarded (bug #143673).
2004-06-05 Sven Neumann <sven@gimp.org>
* plug-ins/common/unsharp.c: applied a modified patch from Geert
Jordaens that adds a preview to the Unsharp Mask plug-in. Fixes
bug #140974.
2004-06-05 Sven Neumann <sven@gimp.org>
* app/paint/gimppaintcore.c
* app/paint-funcs/paint-funcs-generic.h
* app/paint-funcs/paint-funcs.[ch]: applied a patch from Philip
Lafleur that changes the way that paint is applied during a paint
stroke. Fixes bug #124225.
2004-06-05 Sven Neumann <sven@gimp.org>
* plug-ins/common/Makefile.am
* plug-ins/common/plugin-defs.pl
* plug-ins/common/glob.c: added a simple glob plug-in based on
some old code by George Hartz. This plug-in is very useful when
you need to do batch processing, especially from Script-Fu.
Fixes bug #143661.
2004-06-05 Sven Neumann <sven@gimp.org>
* app/widgets/gimpgradienteditor.c: applied a patch from David
Gowers that makes the gradient editor display the perceptual
intensity of the color under the cursor (bug #135037).
2004-06-05 Sven Neumann <sven@gimp.org>
* plug-ins/common/snoise.c: applied a modifed patch from Yeti that
adds a preview to the Solid Noise plug-in (bug #142587).
2004-06-05 Sven Neumann <sven@gimp.org>
* plug-ins/common/tiff.c: save the proper value for type of alpha
channel. Fixes bug #143522; patch by Philip Lafleur.
2004-06-05 Manish Singh <yosh@gimp.org>
* app/gui/preferences-dialog.c (prefs_dialog_new): update call
to prefs_spin_button_add for num-processors too.
2004-06-05 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-scripts.c (script_fu_interface):
left align toggle buttons.
2004-06-05 Sven Neumann <sven@gimp.org>
* app/text/gimptextlayer-transform.[ch]: updated the (still unused)
text transformation code.
* app/text/gimptext-bitmap.c: removed a redundant transformation.
2004-06-05 Michael Natterer <mitch@gimp.org>
* cursors/Makefile.am
* cursors/cursor-none.png
* cursors/xbm/cursor-none.xbm: new empty cursor images.
* app/config/gimpdisplayconfig.[ch]
* app/config/gimprc-blurbs.h
* app/widgets/widgets-enums.h
* app/widgets/gimpcursor.c
* app/display/gimpdisplayshell-cursor.c
* app/tools/gimppainttool.[ch]
* app/tools/gimpinktool.c
* app/gui/preferences-dialog.c: applied patches from Philip
Lafleur which implement hiding the cursor completely for paint
tools. Changed the name of the config option from
"hide-paint-tool-cursor" to "show-paint-tool-cursor" and default
to TRUE because this needs the brush outline being visible while
painting to be really usable. Fixes bug #132163.
* app/widgets/widgets-enums.h: renamed all GimpCursorType and
GimpToolCursorType enum values to GIMP_CURSOR_* and
GIMP_TOOL_CURSOR_*.
* app/widgets/gimpcursor.c
* app/display/gimpdisplayshell-callbacks.c
* app/display/gimpdisplayshell-cursor.c
* app/tools/gimp*tool.c; changed accordingly.
2004-06-04 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcursor.c: changed create_cursor_foo() utility
functions to get_cursor_foo() and use them as accessors instead of
using cursor->member. Use gdk_pixbuf_copy() instead of compositing
the initial image onto an empty pixbuf.
2004-06-04 Sven Neumann <sven@gimp.org>
* app/widgets/gimptexteditor.c (gimp_text_editor_new): set the
focus on the text area.
2004-06-04 Sven Neumann <sven@gimp.org>
* app/tools/gimptexttool.c (gimp_text_tool_class_init): allow to
move a text layer using the cursor keys.
2004-06-04 Michael Natterer <mitch@gimp.org>
* cursors/*.xbm: removed...
* cursors/xbm/*.xbm: ...and added here instead. Renamed them
all to match the PNG file names.
* cursors/Makefile.am: changed accordingly.
* app/widget/gimpcursor.c: ditto. Merged the two cursor creating
functions again because they duplicated too much code.
2004-06-04 Sven Neumann <sven@gimp.org>
* app/menus/plug-in-menus.c (plug_in_menus_setup): populate the
tree with collation keys and use strcmp() instead of
g_utf8_collate() as the tree's sort function.
2004-06-04 Sven Neumann <sven@gimp.org>
* app/paint/gimppaintoptions.c (DEFAULT_PRESSURE_PRESSURE):
applied a patch by Philip Lafleur that changes the default to
FALSE. Fixes bug #143626.
2004-06-03 Michael Natterer <mitch@gimpmp.org>
* app/widgets/gimptoolbox.c (gimp_toolbox_size_allocate): use
gtk_widget_size_request() instead of _get_child_requisition()
because we need to know the size of the toolbox' areas
even if they are invisible. Fixes SIGFPE spotted by Jimmac.
2004-06-03 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcursor.c: some cleanup. Make the tool_cursor
and cursor_modifier components slightly transparent.
* cursors/cursor-mouse.png: was the wrong image.
2004-06-03 Michael Natterer <mitch@gimp.org>
* cursors/Makefile.am
* cursors/*.png: added PNG version of all cursors.
* cursors/gimp-tool-cursors.xcf: reordered and renamed all layers
to match the new PNG filenames.
* app/widgets/gimpcursor.[ch]: create cursors with alpha and color
if the GdkDisplay supports it. Fall back to the old stuff
otherwise.
2004-06-03 Sven Neumann <sven@gimp.org>
* app/core/gimppattern.c (gimp_pattern_load_pixbuf): if a Title is
set, use that as the pattern name.
2004-06-03 Sven Neumann <sven@gimp.org>
* app/core/gimpdatafactory.c (gimp_data_factory_load_data):
removed commented-out message.
* app/core/gimppattern.[ch]: fixed handling of errors and PNG
comments in new pattern loader. Renamed functions for consistency
with other data loaders.
* app/core/gimp.c: changed accordingly.
2004-06-03 Dave Neary <bolsh@gimp.org>
* app/core/gimp.c:
* app/core/gimpdatafactory.c:
* app/core/gimppattern.[ch]: Add support for GdkPixbuf patterns,
so now all of png, jpex, pnm, xbm, bmp, gif, ico, pcx, ras, tga,
xpm and tiff can be used for patterns.
2004-06-03 Michael Natterer <mitch@gimp.org>
* app/actions/vectors-actions.c: added alternative actions
"vectors-selection-from-vectors" and
"vectors-selection-to-vectors-short" with different labels suited
for the "Select" menu.
* app/actions/select-actions.c: removed "select-from-vectors"
and "select-to-vectors" (to vectors was crashing anyway).
* app/actions/select-commands.[ch]: removed
select_from_vectors_cmd_callback(). Fixes code dupliction.
* menus/image-menu.xml.in
* menus/selection-editor-menu.xml: changed accordingly.
2004-06-03 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpgradienteditor.c (control_motion): use the newly
added GimpGradient API to set the segment's handles instead of
setting the values directly. Dirties the gradient correctly and
makes the preview update instantly again. Fixes bug #143605.
2004-06-03 Sven Neumann <sven@gimp.org>
* app/gui/file-open-location-dialog.c
(file_open_location_completion): check for NULL pointer before
passing it to g_utf8_normalize(). Just a workaround for a problem
in GimpContainerView.
2004-06-02 Sven Neumann <sven@gimp.org>
* INSTALL: more updates.
2004-06-02 Sven Neumann <sven@gimp.org>
* Made 2.1.0 development release.
2004-06-02 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-scale.c
* app/gui/info-window.c
* app/gui/preferences-dialog.c
* app/gui/resize-dialog.c
* app/tools/gimpcolorbalancetool.c
* app/tools/gimpcurvestool.c
* app/tools/gimphuesaturationtool.c
* app/tools/gimplevelstool.c
* app/tools/gimpthresholdtool.c
* app/widgets/gimpdockable.c
* app/widgets/gimpfiledialog.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimphistogrambox.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpstrokeeditor.c: tweaked some spacings for
consistency and better HIG compliance.
2004-06-02 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/gradient_edit.pdb: set_blending_function() and
set_coloring_type() work on segment ranges, renamed them
accordingly. Spotted by Shlomi Fish.
* app/pdb/gradient_edit_cmds.c
* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
2004-06-02 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdnd.[ch]: removed utility funtion
gimp_dnd_open_files().
* app/widgets/gimptoolbox-dnd.c: added gimp_toolbox_drop_files()
instead.
* app/display/gimpdisplayshell-dnd.c (gimp_display_shell_drop_files):
show the error message if opening a dropped file fails.
2004-06-02 Sven Neumann <sven@gimp.org>
* libgimpthumb/gimpthumbnail.c: plugged a small memory leak.
2004-06-02 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdnd.h: removed enum GimpDndType...
* app/widgets/widgets-enums.h: ...and added it here.
* app/widgets/gimpdnd.c: added more g_return_if_fail(). Allow
all gimp_dnd_foo_dest_add() functions to be called without
callback (just add the target if callback is NULL).
(gimp_dnd_open_files): removed the checks for validity of the
passed filenames/uris...
(gimp_dnd_set_file_data): ...and added it here so all callbacks
get an already sanitized list of strings.
2004-06-02 Sven Neumann <sven@gimp.org>
* app/actions/Makefile.am (EXTRA_DIST)
* app/menus/Makefile.am (EXTRA_DIST): removed makefile.msc until
they have been added.
2004-06-02 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcontainerview.c: create the hash table when
inserting items; removes redundant create/destroy cycles and plugs
a memory leak.
2004-06-02 Sven Neumann <sven@gimp.org>
* INSTALL: updated for gimp-2.1. Suggest to use gimp-print
version 4.2.7-pre1 in case of problems (see bug #138273).
2004-06-02 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell-dnd.c
(gimp_display_shell_drop_files): copy the merged layer, not the
first one. Preserve the type of the layer to make e.g. dropping an
XCF with a single text layer work.
2004-06-02 Sven Neumann <sven@gimp.org>
* NEWS
* README: updated.
2004-06-02 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell.c (gimp_display_shell_init): accept
file/uri drops.
* app/display/gimpdisplayshell-dnd.[ch]
(gimp_display_shell_drop_files): open any kind of image and turn
it into a single layer which is added to the image (suggested by
Antenne Springborn).
2004-06-02 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/gradient_edit.pdb
* tools/pdbgen/pdb/gradients.pdb: mark new API as new using $since.
* libgimp/gimpgradientedit_pdb.c
* libgimp/gimpgradients_pdb.c: regenerated.
2004-06-02 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/gradient_edit.pdb: forgot two more s/int32/enum/.
* app/pdb/gradient_edit_cmds.c
* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
2004-06-01 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/image.pdb
* app/pdb/image_cmds.c
* app/core/gimpimage.[ch]: reverted changes I did to the image
unit earlier. As in 2.0, it will continue to not accept pixels.
This makes the PDB API and the XCF format compatible again and
fixes bug #142961 (and to some extent bug #137704).
* app/core/Makefile.am
* app/core/gimpimage-unit.[ch]: removed these files. The
convenience accessors defined here aren't commonly used any
longer.
* app/display/gimpdisplay.[ch]
* app/display/gimpdisplayshell.[ch]: added a unit parameter to
gimp_display_new(). Made "unit" and "scale" properties of
GimpDisplayShell.
* app/actions/image-commands.c
* app/actions/images-commands.c
* app/actions/layers-commands.c
* app/actions/select-commands.c
* app/actions/view-commands.c
* app/core/gimp-edit.c
* app/core/gimp.[ch]
* app/core/gimptemplate.c
* app/display/gimpdisplayshell-handlers.c
* app/display/gimpdisplayshell-scale.c
* app/display/gimpdisplayshell-title.c
* app/display/gimpstatusbar.c
* app/file/file-open.c
* app/gui/gui-vtable.c
* app/gui/info-window.c
* app/gui/offset-dialog.c
* app/gui/resize-dialog.[ch]
* app/pdb/display_cmds.c
* app/tools/gimpcroptool.c
* app/tools/gimpmeasuretool.c
* app/tools/gimppainttool.c
* app/tools/gimprectselecttool.c
* app/tools/gimprotatetool.c
* app/tools/gimpscaletool.c
* app/vectors/gimpvectors-export.c
* app/widgets/gimptoolbox-dnd.c
* tools/pdbgen/pdb/display.pdb: changed accordingly. Use the
display unit where the image unit was used before.
2004-06-01 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/gradient_edit.pdb: use enums instead of
integers, cleanup.
* app/pdb/gradient_edit_cmds.c
* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
2004-06-01 Michael Natterer <mitch@gimp.org>
* app/core/gimpdatafactory.[ch]: added new function
gimp_data_factory_data_delete().
* app/actions/data-commands.c (data_delete_callback): use it.
* tools/pdbgen/pdb/gradients.pdb: applied (slightly modified)
patch from Shlomi Fish which adds PDB wrappers to create, delete,
duplicate and rename gradients. Fixes bug #143528.
* app/pdb/gradients_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpgradients_pdb.[ch]: regenerated.
2004-06-01 Michael Natterer <mitch@gimp.org>
* app/core/core-enums.h: renamed the values of the
GimpGradientSegment* enums from GIMP_GRAD_* to
GIMP_GRADIENT_SEGMENT_* because they are exported now.
* app/core/gimp-gradients.c
* app/core/gimpgradient.c
* app/actions/gradient-editor-actions.c: changed accordingly.
* libgimp/gimpenums.h
* plug-ins/pygimp/gimpenums.py
* plug-ins/script-fu/script-fu-constants.c
* tools/pdbgen/enums.pl: regenerated.
2004-06-01 Sven Neumann <sven@gimp.org>
* plug-ins/common/tiff.c: don't call gtk_entry_set_text() with a
NULL text.
2004-06-01 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpitemtreeview.c: some cleanup in the tree view
DND code.
2004-06-01 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpsessioninfo.c (gimp_session_info_restore): added
a horrible hack that sets the paned's position after the first
"size-allocate" after "map". Makes position remembering work for
the toolbox and fixes bug #142697.
* app/widgets/gimpdockable.[ch]: added new function
gimp_dockable_set_tab_style()
* app/actions/dockable-commands.c (dockable_tab_style_cmd_callback)
* app/widgets/gimpsessioninfo.c (gimp_session_info_restore):
use gimp_dockable_set_tab_style().
2004-06-01 Michael Natterer <mitch@gimp.org>
* app/widgets/gimptoolbox.c (toolbox_area_notify): removed
unused variable.
2004-06-01 Sven Neumann <sven@gimp.org>
* plug-ins/common/autocrop.c (query): register as "Autocrop Image"
and "Autocrop Layer".
2004-06-01 Sven Neumann <sven@gimp.org>
* app/actions/image-commands.c (image_new_cmd_callback):
initialize the dialog by calling file_new_dialog_set(). Fixes bug
#143477.
2004-05-31 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcontainerentry.[ch]: export the column enum.
* app/gui/file-open-location-dialog.c: use a GimpContainerEntry
on the documents list. Use a custom match function that matches
without the leading protocol part.
2004-05-31 Michael Natterer <mitch@gimp.org>
* app/widgets/Makefile.am
* app/widgets/gimptoolbox-image-area.[ch]: new toolbox area which
shows the active image.
* app/config/gimpguiconfig.[ch]
* app/config/gimprc-blurbs.h: added config options to control the
visibility of the toolbox' color, indicator and image areas.
* app/widgets/gimptoolbox.[ch]: added the image area and honor the
new config options. Put the various areas into their own wrap box.
* app/widgets/gimptoolbox-dnd.c: changed accordingly.
* app/widgets/gimphelp-ids.h: added a help ID for the image area.
* app/widgets/gimptoolbox-indicator-area.c: made the previews
a bit larger, cleanup.
* app/gui/preferences-dialog.c: added a "Toolbox" page as GUI for
the new config options.
* themes/Default/images/preferences/Makefile.am
* themes/Default/images/preferences/toolbox.png: a (wrong) icon
for the "Toolbox" prefs page. Needs to be replaced.
2004-05-31 Sven Neumann <sven@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpcontainerentry.[ch]: added new widget
GimpContainerEntry, a GtkEntry with completion that implements the
GimpContainerView interface.
* app/tools/gimptextoptions.c (gimp_text_options_gui): added a
GimpContainerEntry to select the font.
2004-05-31 Sven Neumann <sven@gimp.org>
* app/Makefile.am
* app/actions/file-actions.c
* app/actions/file-commands.[ch]
* app/gui/Makefile.am
* app/gui/file-open-location-dialog.[ch]
* app/widgets/gimphelp-ids.h
* menus/image-menu.xml.in
* menus/toolbox-menu.xml.in: added a rudimentary "Open Location"
dialog.
2004-05-31 Sven Neumann <sven@gimp.org>
* plug-ins/common/mblur.c (mblur_zoom): push pixels outwards not
to the center as suggested by Chad Daelhousen (bug #142968).
2004-05-31 Sven Neumann <sven@gimp.org>
* plug-ins/common/mblur.c: applied patch from William Skaggs that
adds the possibility to choose the center of radial and zoom
motion blurs (bug #113711).
2004-05-31 Sven Neumann <sven@gimp.org>
* app/paint/gimpconvolve.c
* app/paint-funcs/paint-funcs.[ch]
* app/tools/gimpiscissorstool.c: reverted last change and applied
new patch instead (bug #72878).
2004-05-31 Sven Neumann <sven@gimp.org>
* app/paint/gimpconvolve.c
* app/paint-funcs/paint-funcs.[ch]
* app/tools/gimpiscissorstool.c: applied a patch from Philip
Lafleur that fixes RGBA resampling in Convolve tool (bug #72878).
2004-05-31 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_cmd_gimp_guides.c
* plug-ins/imagemap/imap_edit_area_info.c
* plug-ins/imagemap/imap_preferences.c
* plug-ins/imagemap/imap_settings.c: need to include gimpwidgets.h.
2004-05-31 Michael Natterer <mitch@gimp.org>
* app/core/core-enums.h
* app/core/gimpgradient.[ch]
* app/pdb/Makefile.am
* app/widgets/gimpgradienteditor.c
* tools/pdbgen/Makefile.am
* tools/pdbgen/groups.pl
* tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi
Fish that adds lots of gradient edit functions to
gimpgradient.[ch] and makes them available through the PDB.
Fixes bug #129675 and bug #129678.
Did some cleanups / enhancments to the patch:
* app/core/gimpgradient.[ch]: changed the naming scheme of the new
functions and changed old functions to match the new scheme.
Introduce a "freeze_count" and public freeze()/thaw() API which
enables subsequent gradient changes without "dirty" being emitted
all the time. Added GimpGradient parameters to all functions
which modify the gradient.
* app/widgets/gimpgradienteditor.c: use the new freeze/thaw
stuff to keep the gradient from updating when not in
"Instant Update" mode.
* app/actions/gradient-editor-commands.c: removed all gradient
editing code and call the new core functions.
* libgimp/Makefile.am
* tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all
added functions. Generate libgimp wrappers for them..
* app/pdb/gradient_edit_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimp_pdb.h
* libgimp/gimpenums.h
* libgimp/gimpgradientedit_pdb.[ch]
* plug-ins/pygimp/gimpenums.py
* plug-ins/script-fu/script-fu-constants.c
* tools/pdbgen/enums.pl: (re)generated.
2004-05-29 Sven Neumann <sven@gimp.org>
* plug-ins/common/autocrop.c: applied patch from Philip Lafleur
that makes Autocrop register a new procedure that autocrops a
single layer as requested in bug #142618.
* tools/pdbgen/pdb/layer.pdb
* app/pdb/layer_cmds.c
* libgimp/gimplayer_pdb.c: fixed documentation for gimp_resize_layer.
Patch provided by Philip Lafleur (bug #142618).
2004-05-29 Sven Neumann <sven@gimp.org>
* app/widgets/gimptemplateeditor.c
(gimp_template_editor_constructor): add the spinbuttons to the
size entry in the correct order. Fixes bug #143347.
2004-05-28 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdnd.c (gimp_dnd_open_files): if the dropped
stuff is a local filename (no file URI), convert it to an
URI instead of forwarding it unmodified.
2004-05-28 Michael Natterer <mitch@gimp.org>
* app/widgets/gimppreview.c (gimp_preview_button_press_event):
don't invoke the popup preview if there is no viewable.
2004-05-28 Sven Neumann <sven@gimp.org>
* app/widgets/gimppropwidgets.c: same workaround for tooltips on
combo boxes.
2004-05-28 Sven Neumann <sven@gimp.org>
* plug-ins/Lighting/lighting_ui.c
* plug-ins/MapObject/mapobject_ui.c
* plug-ins/common/warp.c
* plug-ins/gfig/gfig.c: tooltips can't be set on a GtkComboBox so
we need to pack it into a GtkEventBox when a tooltip is needed.
2004-05-28 Michael Natterer <mitch@gimp.org>
* app/text/gimpfont.c (gimp_font_get_popup_size)
(gimp_font_get_new_preview): take both logical and ink rectangle
into account to avoid clipping away parts of the font preview.
Fixes bug #142277.
2004-05-28 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainerview.[ch]: added "preview-size" and
"preview-border-width" properties. Cleanup.
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainercombobox.c: implement them.
2004-05-28 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainergridview.[ch]
* app/widgets/gimpcontainertreeview.[ch]: removed "reorderable"
from gimp_container_foo_view_new().
* app/widgets/gimpcontainereditor.[ch]: removed "reorderable" from
gimp_container_editor_construct(). Automatically set the view to
reorderable if the viewed container has no sort_func.
* app/widgets/gimpbufferview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpdocumentview.c
* app/widgets/gimpimageview.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptoolview.c
* app/widgets/gimpundoeditor.c: removed reoderable stuff because
GimpContainerEditor does this generically now.
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpfontview.c: set reorderable to FALSE because
they should not be reodered even if they don't have a sort_func.
* app/gui/font-select.c: removed reorderable stuff. Some cleanup.
* app/gui/brush-select.c
* app/gui/gradient-select.c
* app/gui/palette-select.c
* app/gui/pattern-select.c: same cleanups as in font-select.c
2004-05-28 Michael Natterer <mitch@gimp.org>
* app/paint/gimpbrushcore.c
* app/paint/gimpdodgeburn.c
* app/paint/gimppaintcore.[ch]
* app/tools/gimpairbrushtool.c
* app/tools/gimpclonetool.c
* app/tools/gimpconvolvetool.c
* app/tools/gimpdodgeburntool.c
* app/tools/gimpinktool.c
* app/tools/gimppaintbrushtool.c
* app/tools/gimppenciltool.c
* app/tools/gimpsmudgetool.c: code review / cleanup.
2004-05-28 Sven Neumann <sven@gimp.org>
* plug-ins/common/CML_explorer.c
* plug-ins/maze/maze_face.c: added size groups.
* plug-ins/common/sinus.c: HIG-ified.
2004-05-28 Sven Neumann <sven@gimp.org>
* plug-ins/Lighting/lighting_ui.c: tuned dialog layout for
consistency.
* plug-ins/common/warp.c: added size groups to nicely align the
widgets.
2004-05-27 Michael Natterer <mitch@gimp.org>
* app/paint/gimp-paint.c (gimp_paint_init): register ink between
airbrush and clone so the stroke dialog's menu of paint functions
has the same order as the default toolbox order.
2004-05-27 Michael Natterer <mitch@gimp.org>
* app/paint/gimppaintcore.[ch]: removed enum GimpPaintCoreFlags
and member GimpPaintCore::flags. Added "gboolean traces_on_window"
to GimpPaintCoreClass (defaults to FALSE).
* app/paint/gimpclone.c: set traces_on_window = TRUE.
* app/paint/gimpbrushcore.[ch]: added
"gboolean handles_changing_brush" to GimpBrushCoreClass (defaults
to FALSE).
* app/paint/gimpclone.c
* app/paint/gimpdodgeburn.c
* app/paint/gimperaser.c
* app/paint/gimppaintbrush.c
* app/paint/gimppaintcore.c: set handles_changing_brush = TRUE.
* app/tools/gimppainttool.c: changed accordingly.
2004-05-27 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/common/ccanalyze.c: code clean-up. Improved speed a lot
(500 percent for 1000 x 1000 RGB image) by replacing O(n^2) algorithm
with O(n) version.
* plug-ins/common/gif.c
* plug-ins/common/gih.c
* plug-ins/common/glasstile.c
* plug-ins/common/gqbist.c
* plug-ins/common/gradmap.c
* plug-ins/common/gtm.c
* plug-ins/common/guillotine.c: Use HIG capitalization style plus
minor code clean-up.
2004-05-27 Sven Neumann <sven@gimp.org>
* plug-ins/common/png.c (respin_cmap): handle an empty colormap.
Fixes bug #143009.
2004-05-27 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimppickbutton.c: applied patch from Philip
Lafleur that fixes color picking for XInput devices (bug #143166).
2004-05-27 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid):
fixed handling of grid offsets in the grid drawing routine.
2004-05-27 Michael Natterer <mitch@gimp.org>
* app/widgets/widgets-enums.[ch]: added enum GimpActiveColor which
can be one of { FOREGROUND, BACKGROUND }.
* app/widgets/Makefile.am
* app/widgets/gimpfgbgeditor.[ch]: new widget implementing the
FG/BG/Swap/Default color area known from the toolbox.
* app/widgets/gimptoolbox-color-area.c: use the new widget.
* app/widgets/gimpcoloreditor.[ch]: replaced the FG/BG buttons and
the color area by a GimpFgBgEditor.
2004-05-27 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdocumentview.c (gimp_document_view_new):
gimp_editor_add_action_button() takes a va_list, terminate
it with NULL. Fixes bug #143258.
2004-05-26 Michael Natterer <mitch@gimp.org>
* app/paint/gimpink.c: restored old time/speed sensitivity
behaviour by doing nothing except figuring if we draw a straight
line in INIT_PAINT. Instead, do all the Blob creating in
MOTION_PAINT and special case the initial (null) "motion"
accordingly.
2004-05-26 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/common/video.c: code clean-up. Twice as fast now.
* plug-ins/common/flarefx.c: removed timing stuff.
2004-05-26 Sven Neumann <sven@gimp.org>
* app/core/core-enums.[ch]: shorter names for the gradient types
to reduce the width of the blend tool options.
2004-05-26 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/common/decompose.c
* plug-ins/common/deinterlace.c
* plug-ins/common/depthmerge.c
* plug-ins/common/despeckle.c
* plug-ins/common/destripe.c
* plug-ins/common/diffraction.c
* plug-ins/common/displace.c
* plug-ins/common/edge.c
* plug-ins/common/emboss.c
* plug-ins/common/engrave.c
* plug-ins/common/exchange.c
* plug-ins/common/film.c
* plug-ins/common/flarefx.c: Use HIG capitalization style.
Added GPL license in a few places. Minor code clean-up.
2004-05-26 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcolordisplayeditor.c
* modules/cdisplay_colorblind.c
* modules/cdisplay_gamma.c
* modules/cdisplay_highcontrast.c
* modules/cdisplay_proof.c: HIG-ified color display filters.
2004-05-26 Michael Natterer <mitch@gimp.org>
* app/paint/gimppaintcore.[ch]: added "guint32 time" parameters
to GimpPaintCore::paint() and ::interpolate().
* app/paint/gimpairbrush.c
* app/paint/gimpbrushcore.c
* app/paint/gimpclone.c
* app/paint/gimpconvolve.c
* app/paint/gimpdodgeburn.c
* app/paint/gimperaser.c
* app/paint/gimppaintbrush.c
* app/paint/gimpsmudge.c: changed accordingly.
* app/paint/gimpink.c: ditto and use the passed time instead of
hardcoded dummy values.
* app/paint/gimppaintcore-stroke.c: pass '0' as time.
* app/tools/gimppainttool.c: pass the GdkEvent time.
2004-05-26 Michael Natterer <mitch@gimp.org>
* app/paint/Makefile.am
* app/paint/gimpink-blob.[ch]
* app/paint/gimpink.[ch]
* app/paint/gimpinkoptions.[ch]: new files. Ported the ink tool
to be a direct GimpPaintCore subclass without any GUI.
* app/paint/gimp-paint.c: register GimpInk with the list of paint
cores.
* app/tools/Makefile.am
* app/tools/gimpinkoptions.[ch]
* app/tools/gimpinktool-blob.[ch]: removed these files.
* app/tools/gimpinkoptions-gui.[ch]: new files containing only
the GUI for GimpInkOptions.
* app/tools/gimpinktool.[ch]: reduced to some few lines which
implement a simple GimpPaintTool subclass.
* app/tools/gimp-tools.c: associate the GimpInk paint_core with
the GimpInkTool.
2004-05-26 Michael Natterer <mitch@gimp.org>
* app/paint/gimppaintcore-stroke.c: check if we really have
a GimpBrushCore before casting and accessing its members.
2004-05-26 Michael Natterer <mitch@gimp.org>
* app/paint/gimpbrushcore.h
* app/paint/gimppaintcore.h: some cleanup.
2004-05-26 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-layer-select.c
* app/display/gimpprogress.c
* app/gui/brush-select.c
* app/gui/color-notebook.c
* app/gui/convert-dialog.c
* app/gui/font-select.c
* app/gui/gradient-select.c
* app/gui/info-dialog.c
* app/gui/offset-dialog.c
* app/gui/palette-select.c
* app/gui/pattern-select.c
* app/gui/stroke-dialog.c
* app/gui/tips-dialog.c
* app/tools/gimpmeasuretool.c
* app/tools/gimptexttool.c
* app/widgets/gimpcolordisplayeditor.c
* app/widgets/gimpcolorframe.c
* app/widgets/gimpdevicestatus.c
* app/widgets/gimpviewabledialog.c: adjusted dialog spacings.
2004-05-26 Michael Natterer <mitch@gimp.org>
* app/paint/gimppaintcore.c: don't do special stuff if a virtual
function doesn't exist. Instead, added default implementations
which do the special stuff and call the virtual functions
unconditionally.
* app/tools/gimppainttool.c: some stylistic cleanup.
2004-05-26 Michael Natterer <mitch@gimp.org>
* app/paint/gimppaintcore.[ch] (gimp_paint_core_paste)
(gimp_paint_core_replace): replaced the "MaskBuf *paint_mask"
parameters by "PixelRegion *mask_bufPR", so subclasses can pass in
any kind of paint_mask buffer and are not restricted to MaskBufs.
Also removes implicit knowledge about the MaskBuf originating from
a brush in paint_mask_to_canvas_buf() and _to_canvas_tiles() which
don't need to offset the mask by width/2 height/2 any more.
Made gimp_paint_core_validate_undo_tiles() and
gimp_paint_core_validate_canvas_tiles() protected functions.
* app/paint/gimpbrushcore.c (gimp_brush_core_paste_canvas)
(gimp_brush_core_replace_canvas): create correctly positioned
PixelRegions from the MaskBufs before passing them to the
paint_core.
2004-05-26 Michael Natterer <mitch@gimp.org>
* app/paint/gimppaintcore.[ch]: removed "gdouble scale" parameter
and added "GimpPaintOptions" in GimpPaintCore::get_paint_area().
Check if virtual functions exist befoe calling them.
* app/paint/gimpbrushcore.[ch]: added "gdouble scale" to GimpBrushCore
and "gboolean use_scale" to GimpBrushCoreClass (defaults to TRUE).
Set scale from paint_options in GimpPaintCore::get_paint_area().
Removed "scale" parameter from gimp_brush_core_paste_canvas()
and _replace_canvas().
* app/paint/gimpsmudge.c (gimp_smudge_class_init): set use_scale
to FALSE.
* app/paint/gimpclone.c
* app/paint/gimpconvolve.c
* app/paint/gimpdodgeburn.c
* app/paint/gimperaser.c
* app/paint/gimppaintbrush.c: removed all scale calculations and
simply pass paint_options to GimpPaintCore::get_paint_area().
2004-05-26 Michael Natterer <mitch@gimp.org>
* app/tools/gimppainttool.c (gimp_paint_tool_button_press): check
if the GimpPaintCore really is a GimpBrushCore before casting and
fiddling with internaly.
2004-05-25 Michael Natterer <mitch@gimp.org>
* app/paint/Makefile.am
* app/paint/gimpbrushcore-kernels.h
* app/paint/gimpbrushcore.[ch]: new GimpPaintCore subclass
containing all the brush painting specific stuff.
* app/paint/gimppaintcore-kernels.h: removed this file.
* app/paint/gimppaintcore.[ch]: removed all brush stuff.
* app/paint/gimpairbrush.c
* app/paint/gimpclone.[ch]
* app/paint/gimpconvolve.[ch]
* app/paint/gimpdodgeburn.[ch]
* app/paint/gimperaser.[ch]
* app/paint/gimppaintbrush.[ch]
* app/paint/gimppencil.c
* app/paint/gimpsmudge.[ch]: changed accordingly. Derive all
classes which used to derive directly from GimpPaintCore from
GimpBrushCore now. Lots of cleanup.
* app/paint/paint-types.h
* app/paint/gimp-paint.c
* app/paint/gimppaintcore-stroke.c
* app/tools/gimppainttool.c
* tools/kernelgen.c: changed accordingly.
2004-05-25 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/common/align_layers.c
* plug-ins/common/animoptimize.c
* plug-ins/common/animationplay.c
* plug-ins/common/apply_lens.c
* plug-ins/common/autocrop.c
* plug-ins/common/autostretch_hsv.c
* plug-ins/common/blinds.c
* plug-ins/common/blur.c
* plug-ins/common/borderaverage.c
* plug-ins/common/bz2.c
* plug-ins/common/c_astretch.c
* plug-ins/common/ccanalyze.c
* plug-ins/common/channel_mixer.c
* plug-ins/common/color_enhance.c
* plug-ins/common/colorify.c
* plug-ins/common/colortoalpha.c
* plug-ins/common/csource.c
* plug-ins/common/cubism.c
* plug-ins/common/curve_bend.c: Use HIG capitalization style.
Added GPL license in a few places. Minor code clean-up.
2004-05-25 Sven Neumann <sven@gimp.org>
Sorry, couldn't resist to finish this task...
* plug-ins/script-fu/script-fu-console.c
* plug-ins/script-fu/script-fu-scripts.c
* plug-ins/script-fu/script-fu-server.c: HIG-ified.
2004-05-25 Sven Neumann <sven@gimp.org>
* plug-ins/gimpressionist/brush.c
* plug-ins/gimpressionist/color.c
* plug-ins/gimpressionist/general.c
* plug-ins/gimpressionist/gimpressionist.[ch]
* plug-ins/gimpressionist/orientation.c
* plug-ins/gimpressionist/orientmap.c
* plug-ins/gimpressionist/paper.c
* plug-ins/gimpressionist/placement.c
* plug-ins/gimpressionist/presets.c
* plug-ins/gimpressionist/preview.c
* plug-ins/gimpressionist/size.c
* plug-ins/gimpressionist/sizemap.c: HIG-ified.
2004-05-25 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpitemtreeview.h: added GimpContext parameters
to GimpActivateItemFunc, GimpNewItemFunc and GimpEditItemFunc.
* app/widgets/gimpdrawabletreeview.c
* app/widgets/gimpitemtreeview.c: pass the view's context to
the functions.
* app/actions/actions.c (action_data_get_context): return
gimp_get_user_context() if "data" is a Gimp.
* app/actions/channels-commands.[ch]
* app/actions/layers-commands.[ch]
* app/actions/vectors-commands.[ch]: added GimpContext parameters
to the resp. activate, new and edit functions and use the passed
context instead of gimp_get_user_context().
* app/actions/layers-commands.[ch]: removed the merge and flatten
callbacks.
* app/actions/image-commands.[ch]: made public layer merge utility
function private and cleaned the whole file up a lot.
* app/actions/layers-actions.c: use the callbacks from
image-commands.c for merge and flatten.
* app/actions/edit-commands.c
* app/actions/file-commands.c
* app/actions/select-commands.c: use action_data_get_context()
instead of gimp_get_user_context().
* app/actions/edit-actions.c: some cleanup.
2004-05-25 Sven Neumann <sven@gimp.org>
* plug-ins/common/plugindetails.c
* plug-ins/dbbrowser/dbbrowser_utils.c
* plug-ins/pagecurl/pagecurl.c: HIG-ified.
2004-05-25 Sven Neumann <sven@gimp.org>
* plug-ins/print/gimp_color_window.c
* plug-ins/print/gimp_main_window.c: HIG-ified and ported to
GtkFileChooser.
* plug-ins/ifscompose/ifscompose.c (ifsfile_load_response): ported
forgotten callback to GtkFileChooser.
* plug-ins/imagemap/imap_browse.c
* plug-ins/imagemap/imap_file.c: finished port to GtkFileChooser.
2004-05-25 Michael Natterer <mitch@gimp.org>
* app/actions/file-actions.c
* app/actions/file-commands.[ch]: removed action "file-new", added
action "file-open-from-image".
* app/actions/image-actions.c
* app/actions/image-commands.[ch]: added actions "image-new" and
"image-new-from-image".
* menus/image-menu.xml.in: use the "-from-image" variants of
the "new" and "open" actions so the dialogs are preconfigured
from the image they were invoked from (regression fix).
* menus/toolbox-menu.xml.in: s/file-new/image-new/.
2004-05-24 Sven Neumann <sven@gimp.org>
* plug-ins/rcm/rcm.h
* plug-ins/rcm/rcm_dialog.[ch]: rearranged and HIG-ified dialog.
2004-05-24 Michael Natterer <mitch@gimp.org>
* app/widgets/gimptoolbox.c (toolbox_create_tools): added an evil
hack as workaround for the missing gtk_action_get_accel_closure().
Re-enables accelerator display in the tool button tooltips.
2004-05-24 Michael Natterer <mitch@gimp.org>
* app/vectors/Makefile.am
* app/vectors/gimpcoordmath.[ch]: removed...
* app/core/Makefile.am
* app/core/gimpcoords.[ch]: ...and added without the "bezier"
namespace.
* app/vectors/gimpbezierstroke.c: changed accordingly.
* app/Makefile.am: force it to link gimpcoords.o
2004-05-24 Michael Natterer <mitch@gimp.org>
* app/config/gimpconfigwriter.c
* app/core/gimpstrokeoptions.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpcolorframe.h
* app/widgets/gimpcolorpanel.h
* app/widgets/gimpcontainerview.[ch]
* app/widgets/gimptooldialog.h
* app/widgets/gimpuimanager.c
* app/widgets/widgets-types.h: fixed various small issues I
stumbled across when updating the API reference for app/.
2004-05-24 Sven Neumann <sven@gimp.org>
* app/display/gimpscalecombobox.c
(gimp_scale_combo_box_mru_remove_last): removed debugging output.
2004-05-24 Sven Neumann <sven@gimp.org>
* app/core/gimptoolinfo.[ch]: derive GimpToolInfo from
GimpViewable, it doesn't make sense for it to be a GimpData.
* app/widgets/gimptooloptionseditor.c
(gimp_tool_options_editor_get_title): do not append " Options" to
the tool name. Fixes bug #142280.
2004-05-24 Sven Neumann <sven@gimp.org>
* plug-ins/common/mblur.c: fixed range check of blur type
parameter (bug #142965).
2004-05-24 Sven Neumann <sven@gimp.org>
* plug-ins/maze/maze_face.c: fixed a compiler warning.
2004-05-24 Sven Neumann <sven@gimp.org>
Applied a patch from Philip Lafleur (bug #142808):
* app/paint/gimppaintcore.h: define PRESSURE_SCALE to 1.5
* app/paint/gimpairbrush.c
* app/paint/gimpclone.c
* app/paint/gimpconvolve.c
* app/paint/gimpdodgeburn.c
* app/paint/gimperaser.c
* app/paint/gimppaintbrush.c
* app/paint/gimpsmudge.c: use the PRESSURE_SCALE constant.
2004-05-24 Michael Natterer <mitch@gimp.org>
Long overdue core container cleanup:
* app/core/gimplist.[ch]: added "unique-names" and "sort-func"
properties and merged the resp. code from GimpDataList into
GimpList. Removed "policy" parameters from gimp_list_new() and
added "unique_names". Added new constructor gimp_list_new_weak().
Made public function gimp_list_uniquefy_name() private.
* app/core/Makefile.am
* app/core/core-types.h
* app/core/gimpdatalist.[ch]: removed. Its functionality is
entirely in GimpList now.
* app/core/gimpdata.[ch]: added gimp_data_name_compare() which
used to live in GimpDataList.
* app/core/gimp.c
* app/core/gimpdatafactory.c
* app/core/gimpimage.c
* app/core/gimptoolinfo.c
* app/core/gimpundostack.c
* app/paint/gimp-paint.c
* app/tools/gimp-tools.c
* app/widgets/gimpdevices.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimpundoeditor.c: changed list creation accordingly.
Made gimp->templates, gimp->named_buffers, tool_info->presets and
the image's lists of layers, channels and vectors automatically
ensure unique names.
* app/widgets/gimptemplateview.c
* app/actions/file-commands.c
* app/actions/templates-commands.c
* app/actions/tool-options-commands.c: removed calls to
gimp_list_uniquefy_name().
* app/core/gimpitem.c: removed major insanity where the items
themselves where ensuring their unique names. Bah!
* app/core/gimplayer.c (gimp_layer_name_changed): chain up
conditionally.
* app/core/gimplayermask.c (gimp_layer_mask_name_changed): removed
because there is no need any more to keep the parent
implementation from being invoked.
2004-05-23 Sven Neumann <sven@gimp.org>
More fixes for bug #142996:
* plug-ins/common/postscript.c
* plug-ins/common/sparkle.c
* plug-ins/common/sunras.c
* plug-ins/common/uniteditor.c
* plug-ins/fits/fits.c: fixed typos.
2004-05-23 Sven Neumann <sven@gimp.org>
Fixes for bug #142996:
* app/gui/preferences-dialog.c: added missing gettext call.
* app/config/gimprc-blurbs.h
* app/core/gimptemplate.c
* app/gui/gradient-editor-menu.c: fixed typos.
2004-05-23 Michael Natterer <mitch@gimp.org>
* app/core/gimpdatalist.c: code cleanup, no logic changed.
2004-05-23 Henrik Brix Andersen <brix@gimp.org>
* app/config/gimprc-blurbs.h
* plug-ins/gfig/gfig-spiral.c (spiral_button_press)
* plug-ins/gimpressionist/orientation.c (create_orientationpage)
* plug-ins/common/diffraction.c (diffraction_dialog)
* plug-ins/common/bumpmap.c (bumpmap_dialog)
* plug-ins/maze/maze.h
* plug-ins/MapObject/mapobject_apply.c (compute_image)
* app/tools/gimpmeasuretool.c (gimp_measure_tool_dialog_update)
* plug-ins/print/gimp_main_window.c (create_scaling_frame): marked
strings for translation, corrected small typos. Fixes part of bug
#142996
2004-05-23 Žygimantas Beručka <uid0@akl.lt>
* configure.in: Added "lt" to ALL_LINGUAS.
2004-05-23 Michael Schumacher <schumaml@cvs.gnome.org>
* libgimp/gimp.def: gimp_register_file_handler_mime added
2004-05-23 Michael Natterer <mitch@gimp.org>
* app/widgets/widgets-types.h: reoedered to somehow reflect the
class hierarchy.
Some dockable context handling cleanup:
* app/widgets/gimpdocked.[ch]: removed "prev_context" parameter
from GimpDocked::set_context(). Widgets which need the old context
to disconnect from should remember it themselves.
* app/widgets/gimpdockable.c (gimp_dockable_set_context): don't
pass the old context to gimp_docked_set_context().
Some cleanup.
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainereditor.c: changed accordingly.
* app/display/gimpnavigationview.[ch]
* app/widgets/gimpimageeditor.[ch]
* app/widgets/gimpitemtreeview.[ch]: added a "context" member
which holds the context set by GimpDocked::set_context().
* app/widgets/gimpdrawabletreeview.c: use the view's context
instead of gimp_get_user_context().
* app/widgets/gimpcoloreditor.[ch]: removed separate API to
set the context because it implements the GimpDockedInterface.
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimperrorconsole.c: pass "menu-factory",
"menu-identifier" and "ui-path" to g_object_new() instead of
calling gimp_editor_create_menu() later.
Action cleanup partly related to the context stuff above:
* app/actions/actions.c (action_data_get_gimp): get the Gimp from
context->gimp, not gimage->gimp because gimage may be NULL.
(action_data_get_context): changed to use the new context members
added above.
* app/actions/channels-actions.c (channels_actions_update): cleanup.
* app/actions/edit-actions.c (edit_actions_update): fixed
sensitivity of "edit-undo-clear".
* app/actions/vectors-actions.c (vectors_actions_update): make
"vectors-merge-visible" sensitive only if there is more than one
GimpVectors in the image.
* app/actions/colormap-editor-actions.c
* app/actions/gradient-editor-actions.c
* app/actions/palette-editor-actions.c: added FG/BG color previews
to actions which take colors from them. Changed code to be safe
against "context" being NULL.
* app/actions/drawable-commands.c:
s/active_drawable/drawable/g. Makes the code more readable.
* app/actions/select-commands.[ch]
* app/actions/vectors-commands.[ch]: removed public stroke utility
functions and other stuff which is not needed any more because
dialog buttons invoke the correct actions now. Moved the
functions' code to the resp. action callbacks.
2004-05-21 Nathan Summers <rock@gimp.org>
Somehow some of the changes from my commit on 2004-05-18 seem to have
gotten lost, including the addition to the ChangeLog. Sorry about that.
Recommitted.
* NEWS: Clarified end-user visible features.
Made sundry small grammar and consistancy fixes.
Reorganized list of changes slightly.
2004-05-21 Sven Neumann <sven@gimp.org>
* app/paint/gimppaintcore.c (gimp_paint_core_interpolate): better
fix for bug #123811; patch provided by Philip Lafleur.
2004-05-21 Sven Neumann <sven@gimp.org>
* app/gui/preferences-dialog.c: added some GtkSizeGroups and
changed spacings to improve the dialog layout.
* app/gui/file-new-dialog.c
* app/widgets/gimpgrideditor.c
* app/widgets/gimptemplateeditor.c: minor changes for consistency.
2004-05-21 Sven Neumann <sven@gimp.org>
* plug-ins/gflare/gflare.c
* plug-ins/gfli/gfli.c
* plug-ins/ifscompose/ifscompose.c
* plug-ins/sel2path/sel2path.c
* plug-ins/sel2path/sel2path_adv_dialog.c
* plug-ins/sgi/sgi.c
* plug-ins/winicon/icodialog.c: HIG-ification.
2004-05-21 Michael Natterer <mitch@gimp.org>
* app/actions/data-commands.c (data_delete_callback): eek, delete
the data only if "OK" was pressed.
2004-05-21 Michael Natterer <mitch@gimp.org>
* app/widgets/gimperrorconsole.c
(gimp_error_console_save_ext_clicked): use
gtk_widget_get_screen(), not window_get_screen() on a button.
2004-05-20 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/imagemap/imap_*.[ch]: (partly) HIG-ified, replaced
deprecated widget GtkCList by GtkTreeModel/View (also fixes #136893),
use file choosers instead of file selectors, minor clean-up.
2004-05-20 Sven Neumann <sven@gimp.org>
* plug-ins/Lighting/lighting_ui.c
* plug-ins/MapObject/mapobject_ui.c
* plug-ins/bmp/bmpwrite.c
* plug-ins/fits/fits.c
* plug-ins/flame/flame.c
* plug-ins/fp/fp.c
* plug-ins/gfig/gfig-preview.c
* plug-ins/gfig/gfig.c: HIG-ified.
2004-05-20 Sven Neumann <sven@gimp.org>
* plug-ins/FractalExplorer/Dialogs.c
* plug-ins/FractalExplorer/FractalExplorer.c: HIG-ification and
some code cleanup.
2004-05-19 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/gimpfu.py: Actually return values from the run
function. Fixes #141338.
2004-05-20 Sven Neumann <sven@gimp.org>
* plug-ins/maze/maze_face.c
* plug-ins/xjt/xjt.c: HIG-ified. Say goodbye to "Parameter Settings".
2004-05-20 Sven Neumann <sven@gimp.org>
* plug-ins/common/warp.c
* plug-ins/common/whirlpinch.c
* plug-ins/common/wmf.c
* plug-ins/common/xbm.c
* plug-ins/common/xpm.c: HIG-ified.
2004-05-19 Manish Singh <yosh@gimp.org>
* app/actions/file-actions.c: remove unnecessary G_OBJECT() casts.
* tools/pdbgen/pdb/help.pdb
* tools/pdbgen/pdb/image.pdb
* tools/pdbgen/pdb/paths.pdb
* tools/pdbgen/pdb/plug_in.pdb: a bit of quoting clean up.
* tools/pdbgen/pdb/plug_in.pdb: handle icon_data_length properly.
* app/pdb/plug_in_cmds.c: regenerated.
2004-05-20 Sven Neumann <sven@gimp.org>
* plug-ins/common/tga.c
* plug-ins/common/threshold_alpha.c
* plug-ins/common/tiff.c
* plug-ins/common/tile.c
* plug-ins/common/tileit.c
* plug-ins/common/uniteditor.c
* plug-ins/common/unsharp.c
* plug-ins/common/video.c
* plug-ins/common/vpropagate.c: HIG-ified.
2004-05-20 Sven Neumann <sven@gimp.org>
* plug-ins/common/randomize.c
* plug-ins/common/ripple.c
* plug-ins/common/sample_colorize.c
* plug-ins/common/scatter_hsv.c
* plug-ins/common/sel_gauss.c
* plug-ins/common/sharpen.c
* plug-ins/common/shift.c
* plug-ins/common/smooth_palette.c
* plug-ins/common/snoise.c
* plug-ins/common/sobel.c
* plug-ins/common/sparkle.c
* plug-ins/common/spread.c
* plug-ins/common/struc.c
* plug-ins/common/sunras.c
* plug-ins/common/svg.c: HIG-ified.
2004-05-19 Michael Natterer <mitch@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpaction.[ch]: new GtkAction subclass which can
show either a color or viewable preview in GtkImageMenuItem
proxies.
* app/widgets/gimpenumaction.[ch]
* app/widgets/gimppluginaction.[ch]
* app/widgets/gimpstringaction.[ch]: derive them from GimpAction.
* app/widgets/gimpactiongroup.c (gimp_action_group_add_actions):
add GimpActions, not GtkActions.
(gimp_action_group_set_action_color)
(gimp_action_group_set_action_viewable): removed all hacks and
simply set the "color" or "viewable" properties of the GimpAction
to change. Fixes color/viewable previews in menus.
* app/actions/file-actions.c: show previews in the "Open Recent"
menu items.
Unrelated:
* app/widgets/widgets-types.h: removed GimpDockedInterface typedef...
* app/widgets/gimpdocked.h: ...and added it here. We don't have
class struct typedefs in the types header either.
* app/actions/edit-actions.c: added <Ctrl>+semicolon as shortcut
for "edit-fill-pattern".
* app/actions/gradient-editor-actions.c: added some stock IDs.
Please comment.
2004-05-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/papertile.c
* plug-ins/common/pat.c
* plug-ins/common/pixelize.c
* plug-ins/common/png.c
* plug-ins/common/postscript.c
* plug-ins/common/psp.c: HIG-ified.
2004-05-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/mapcolor.c
* plug-ins/common/mblur.c
* plug-ins/common/mng.c
* plug-ins/common/mosaic.c
* plug-ins/common/newsprint.c
* plug-ins/common/oilify.c: HIG-ified.
2004-05-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/hot.c
* plug-ins/common/iwarp.c
* plug-ins/common/jpeg.c
* plug-ins/common/lic.c
* plug-ins/common/mail.c: HIG-ified.
2004-05-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/gauss_iir.c
* plug-ins/common/gauss_rle.c
* plug-ins/common/gbr.c
* plug-ins/common/gee.c
* plug-ins/common/gee_zoom.c
* plug-ins/common/gif.c
* plug-ins/common/gih.c
* plug-ins/common/glasstile.c
* plug-ins/common/gtm.c: HIG-ified.
2004-05-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/exchange.c: fixed minor dialog layout issues.
* plug-ins/common/screenshot.c: added the camera icon to the dialog.
* plug-ins/common/film.c
* plug-ins/common/fractaltrace.c: HIG-ified.
2004-05-19 Sven Neumann <sven@gimp.org>
* app/paint/gimppaintcore.c (gimp_paint_core_interpolate): make
sure that pressure never becomes negative. Fixes bug #123811;
thanks to Philip Lafleur for investigating this problem.
2004-05-19 Sven Neumann <sven@gimp.org>
* plug-ins/common/channel_mixer.c: added some stock icons.
* plug-ins/common/edge.c
* plug-ins/common/emboss.c
* plug-ins/common/engrave.c
* plug-ins/common/exchange.c: HIG-ified.
* plug-ins/common/sel_gauss.c: tiny changes for a more consistent
HIG-ification.
2004-05-19 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/plug_in.pdb: made plugin_icon_register() an
underscore-prefixed function which needs to be wrapped.
* libgimp/gimpplugin_pdb.[ch]: regenerated.
* libgimp/Makefile.am
* libgimp/gimp.h
* libgimp/gimpplugin.[ch]: new files containing
gimp_plugin_icon_register() which has no "icon_data_length"
parameter and determines it from the passed icon data.
* libgimp/gimp.def: added gimp_plugin_icon_register.
* plug-ins/common/plugindetails.c
* plug-ins/common/screenshot.c
* plug-ins/common/uniteditor.c
* plug-ins/print/print.c: don't pass the icon_data_length.
2004-05-18 Sven Neumann <sven@gimp.org>
* plug-ins/common/checkerboard.c
* plug-ins/common/colorify.c
* plug-ins/common/colortoalpha.c
* plug-ins/common/compose.c
* plug-ins/common/convmatrix.c
* plug-ins/common/csource.c
* plug-ins/common/cubism.c
* plug-ins/common/decompose.c
* plug-ins/common/deinterlace.c
* plug-ins/common/depthmerge.c
* plug-ins/common/despeckle.c
* plug-ins/common/destripe.c
* plug-ins/common/diffraction.c
* plug-ins/common/displace.c: HIG-ified.
2004-05-18 Michael Natterer <mitch@gimp.org>
Allow plug-ins to register menu icons. Fixes bug #120500.
* app/core/core-enums.[ch]: added enum GimpIconType which can
be one of { STOCK_ID, IMAGE_FILE, INLINE_PIXBUF }.
* app/config/gimpconfigwriter.[ch] (gimp_config_writer_data)
* app/config/gimpscanner.[ch] (gimp_scanner_parse_data): new
functions which write/parse raw binary data. Needed for storing
inline pixbufs in pluginrc.
* app/config/gimpconfigwriter.[ch] (gimp_config_writer_identifier):
new function which writes out an unquoted and unescaped string.
* app/plug-in/plug-in-proc.[ch] (struct PlugInProcDef): added
new members "icon_type", "icon_data_length" and "icon_data".
Reordered members so file_proc specific stuff is at the end.
(plug_in_proc_def_get_stock_id)
(plug_in_proc_def_get_pixbuf): new functions to access the
procedure's icon.
* app/plug-in/plug-in-rc.c: save/restore the registered icons.
* app/actions/file-dialog-actions.c
* app/actions/plug-in-actions.c: set the action's stock ID from
the procedure's stock ID.
* app/widgets/gimppluginaction.c
(gimp_plug_in_action_connect_proxy): if the procedure provides a
pixbuf, set it as icon for the menu item.
* app/menus/file-dialog-menu.[ch]
* app/menus/file-open-menu.c
* app/menus/file-save-menu.c
* app/xcf/xcf.c: changed accordingly.
* tools/pdbgen/pdb/plug_in.pdb (plugin_icon_register): new PDB
function which can be called during query().
* tools/pdbgen/enums.pl
* app/pdb/internal_procs.c
* app/pdb/plug_in_cmds.c
* libgimp/gimpenums.h
* libgimp/gimpplugin_pdb.c
* libgimp/gimpplugin_pdb.h
* plug-ins/pygimp/gimpenums.py
* plug-ins/script-fu/script-fu-constants.c: regenerated.
* plug-ins/common/plugindetails.c
* plug-ins/common/uniteditor.c
* plug-ins/print/print.c: register stock_id icons.
* plug-ins/common/screenshot.c: register an inline_pixbuf icon for
testing purposes (used emblem-camera.png from gnome-icon-theme).
* app/actions/dialogs-actions.c
* app/actions/file-actions.c: unrelated: added some more icons
to menu items.
2004-05-18 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/common/sel_gauss.c: HIGified, fixed indendation, speed
improvement (around 70 %).
2004-05-18 Sven Neumann <sven@gimp.org>
* plug-ins/common/blur.c
* plug-ins/common/borderaverage.c
* plug-ins/common/bumpmap.c
* plug-ins/common/ccanalyze.c: HIG-ified.
2004-05-18 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpsizeentry.[ch] (gimp_size_entry_attach_label):
return the created label widget so that it can for example be put
into a GtkSizeGroup.
* plug-ins/libgimpoldpreview/gimpoldpreview.[ch]: removed the
optional "Preview" frame. Always put the preview into a sunken
frame.
* plug-ins/common/AlienMap2.c
* plug-ins/common/blinds.c
* plug-ins/common/flarefx.c
* plug-ins/common/glasstile.c
* plug-ins/common/grid.c
* plug-ins/common/illusion.c
* plug-ins/common/jigsaw.c
* plug-ins/common/max_rgb.c
* plug-ins/common/nlfilt.c
* plug-ins/common/noisify.c
* plug-ins/common/nova.c
* plug-ins/common/plasma.c
* plug-ins/common/polar.c
* plug-ins/common/waves.c
* plug-ins/common/wind.c: changed accordingly, HIG-ified.
2004-05-18 Sven Neumann <sven@gimp.org>
* plug-ins/common/aa.c
* plug-ins/common/align_layers.c
* plug-ins/common/animationplay.c
* plug-ins/common/apply_lens.c: HIG-ified.
2004-05-18 Michael Natterer <mitch@gimp.org>
* app/core/gimptoolinfo.c: made the "visible" property serializable.
* app/tools/gimp-tools.c: store the tools' order and visibility
in a new config file called "toolrc".
2004-05-18 Sven Neumann <sven@gimp.org>
* plug-ins/gimpressionist/brush.c: ported to GtkFileChooser.
* plug-ins/gimpressionist/gimpressionist.h
* plug-ins/gimpressionist/ppmtool.[ch]: sprinkled some const
qualifiers.
2004-05-18 Sven Neumann <sven@gimp.org>
* plug-ins/common/curve_bend.c
* plug-ins/ifscompose/ifscompose.c: ported to GtkFileChooser and
HIG-ified.
2004-05-18 Sven Neumann <sven@gimp.org>
* plug-ins/common/channel_mixer.c
* plug-ins/common/gqbist.c: ported to GtkFileChooser and
HIG-ified.
* plug-ins/common/spheredesigner.c: ditto, but needs more love.
2004-05-18 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_label): new
function which returns a newly allocated string which is the menu
item's name stripped of mnemonics an ellipses.
* app/actions/plug-in-actions.c (plug_in_actions_update)
* app/plug-in/plug-in.c (plug_in_get_undo_desc): use the function
instead of implementing the same twice slightly different.
2004-05-17 Sven Neumann <sven@gimp.org>
* plug-ins/common/CEL.c
* plug-ins/common/CML_explorer.c: ported to GtkFileChooser and
HIG-ified.
2004-05-17 Sven Neumann <sven@gimp.org>
* plug-ins/common/AlienMap2.c: HIG-ified (more or less).
2004-05-17 Michael Natterer <mitch@gimp.org>
* menus/menus.xsl: put the image popup menu into a dummy menubar
to work around the silly GtkUIManager restriction that popup menus
can't have tearoff items.
* app/menus/menus.c
* app/menus/image-menu.c
* app/display/gimpdisplayshell-callbacks.c
* app/gui/gui-vtable.c
* app/menus/plug-in-menus.c: changed accordingly.
* app/gui/gui.c (gui_restore_after_callback): connect to
"notify::tearoff-menus" of GimpGuiConfig and reconfigure the
global image UI manager accordingly.
* app/config/gimpguiconfig.c: removed GIMP_PARAM_RESTART from the
"tearoff-menus" property because GtkUIManager can change this on
the fly.
* app/display/gimpdisplayshell.[ch]: added the menubar to the
GimpDisplayShell struct. Some cleanup in gimp_display_shell_new().
* app/display/gimpdisplayshell-appearance.c
(gimp_display_shell_set_show_menubar): use shell->menubar instead
of asking the UI manager.
* app/widgets/gimpuimanager.[ch]: changed gimp_ui_manager_ui_get()
to transparently load the XML files even if a sub-widget was
requested. Reordered parameters of gimp_ui_manager_ui_popup().
Lots of internal cleanups.
* app/widgets/gimpdockable.c
* app/widgets/gimptooloptionseditor.c: simplified accordingly.
* app/widgets/gimpeditor.[ch]: added new function
gimp_editor_popup_menu() which takes a GimpMenuPositionFunc and
updates/shows the editor's menu.
* app/widgets/gimpcolormapeditor.c
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimperrorconsole.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimppaletteeditor.c: use gimp_editor_popup_menu().
* app/widgets/gimptoolbox.c: moved all code from
gimp_toolbox_new() to GObject::constructor().
2004-05-17 Michael Natterer <mitch@gimp.org>
* app/actions/tool-options-actions.c: added icons to the Save,
Load, Rename and Delete submenus.
2004-05-17 Michael Natterer <mitch@gimp.org>
* app/actions/edit-actions.c (edit_actions_update): don't forget
to set the sensitivity of "edit-named-copy".
2004-05-17 Sven Neumann <sven@gimp.org>
* app/core/gimpimage.c (gimp_image_init): initialize the image
unit to GIMP_UNIT_PIXEL.
* app/pdb/image_cmds.c
* tools/pdbgen/pdb/image.pdb: allow GIMP_UNIT_PIXEL to be used
in the gimp_image_set_unit() PDB call.
2004-05-16 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/old-photo.scm: fixed wrong use of
layer ID; bug #142326.
2004-05-15 Sven Neumann <sven@gimp.org>
* app/tools/gimpcurvestool.c: fixed position of vertical line
indicating the picked color. Patch from William Skaggs and
Søren Wedel Nielsen; fixes bug #142506.
2004-05-15 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in-params.c (plug_in_proc_args_check): changed
warnings to include the invalid menu path. Added check that makes
sure menu paths are either "<Prefix>" or "<Prefix>/foo" but *not*
"<Prefix>foo".
* app/actions/plug-in-actions.c: added function
plug_in_actions_check_translation() which validates both the
original and translated menu paths and spits detailed error
messages if any of them is broken. Made action creation simpler
(?) and more robust.
* app/menus/plug-in-menus.c: argh, the translated menu path must
be a sorting criteria *only*. Fixed the whole stuff to always use
the original menu path because translation is done entirely by
plug-in-actions.c. Fixes bad crashes for all locales. Added
boolean return value to plug_in_menus_build_path() and don't try
to create the menu item in an invalid location if creating the
submenus failed.
2004-05-14 Sven Neumann <sven@gimp.org>
* app/menus/file-dialog-menu.c: check if the file procedure
registered a menu path at all. The menu should probably be created
from the registered menu path, not from gimp->[load|save]_procs.
* app/plug-in/plug-in-proc.[ch]
* app/plug-in/plug-ins.c: removed broken code that used to sort
the file procedures.
* plug-ins/common/CEL.c
* plug-ins/common/bz2.c
* plug-ins/common/gz.c
* plug-ins/common/pcx.c
* plug-ins/common/pix.c
* plug-ins/common/sunras.c
* plug-ins/sgi/sgi.c
* plug-ins/xjt/xjt.c: register a mimetype, set a translatable
action name (mostly taken from shared-mime-info) and register to
the <Load> and <Save> menus using gimp_plugin_menu_register().
2004-05-14 Michael Natterer <mitch@gimp.org>
* app/pdb/fileops_cmds.c
* libgimp/gimpfileops_pdb.c: regenerated.
2004-05-14 Michael Natterer <mitch@gimp.org>
* app/actions/select-actions.c (select_actions_update): don't
make "select-invert" insensitive if there is no selection.
2004-05-14 Sven Neumann <sven@gimp.org>
* plug-ins/common/aa.c
* plug-ins/common/gbr.c
* plug-ins/common/gih.c
* plug-ins/common/gtm.c
* plug-ins/common/header.c
* plug-ins/common/pat.c
* plug-ins/common/pnm.c
* plug-ins/common/psp.c
* plug-ins/fits/fits.c
* plug-ins/gfli/gfli.c: register a mimetype, set a translatable
action name (mostly taken from shared-mime-info) and register to
the <Load> and <Save> menus using gimp_plugin_menu_register().
2004-05-14 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/fileops.pdb: added new PDB function
gimp_register_file_handler_mime() that allows to associate a MIME
type with a file procecdurre.
* app/pdb/fileops_cmds.c
* app/pdb/internal_procs.c
* libgimp/gimpfileops_pdb.[ch]: regenerated.
* app/plug-in/plug-in-proc.[ch]
* app/plug-in/plug-in-rc.c
* app/plug-in/plug-ins.[ch]: store a mimetype with file procedures.
* app/actions/file-commands.c
* app/core/gimpdocumentlist.[ch]
* app/core/gimpimagefile.[ch]
* app/file/file-open.[ch]
* app/file/file-save.c: set the thumbnail's mimetype from the file
procedure used to load/save the image.
* app/xcf/xcf.c
* plug-ins/bmp/bmp.c
* plug-ins/common/csource.c
* plug-ins/common/dicom.c
* plug-ins/common/gif.c
* plug-ins/common/gifload.c
* plug-ins/common/jpeg.c
* plug-ins/common/mng.c
* plug-ins/common/png.c
* plug-ins/common/postscript.c
* plug-ins/common/psd.c
* plug-ins/common/psd_save.c
* plug-ins/common/sunras.c
* plug-ins/common/svg.c
* plug-ins/common/tga.c
* plug-ins/common/tiff.c
* plug-ins/common/wmf.c
* plug-ins/common/xbm.c
* plug-ins/common/xpm.c
* plug-ins/common/xwd.c
* plug-ins/faxg3/faxg3.c
* plug-ins/winicon/main.c: register a mimetype, set a translatable
action name (taken from shared-mime-info) and register to the <Load>
and <Save> menus using gimp_plugin_menu_register().
2004-05-13 Sven Neumann <sven@gimp.org>
* tools/pdbgen/lib.pl
* tools/pdbgen/pdbgen.pl: added new procedure variable 'since'
that allows to specify when a new function was added. Use that
info to generate an appropriate gtk-doc comment.
* tools/pdbgen/pdb/plug_in.pdb: set since = '2.2' for the new
function gimp_plugin_menu_register().
* libgimp/gimpplugin_pdb.c: regenerated.
2004-05-13 Michael Natterer <mitch@gimp.org>
* menus/tool-options-menu.xml: added "name" attributes to all
submenus.
* app/menus/tool-options-menu.c: use the menu names instead of the
overly long action names.
* app/actions/colormap-editor-commands.c
* app/actions/tool-options-commands.c: added some callback
implementations.
* app/widgets/gimpcolormapeditor.c
* app/widgets/gimptooloptionseditor.c: removed the callbacks here
and use action buttons.
* app/actions/actions.c
* app/actions/colormap-editor-actions.c
* app/actions/edit-actions.c: code review / cleanup.
2004-05-13 Michael Natterer <mitch@gimp.org>
* app/core/gimpcontainer.c (gimp_container_add_handler): don't
try to lookup detailed "notify::foo" signal specs.
2004-05-13 Michael Natterer <mitch@gimp.org>
* app/widgets/gimptoolview.[ch]: if in list mode, add an "eye"
column which toggles tool visibility.
2004-05-13 Michael Natterer <mitch@gimp.org>
* app/actions/tools-actions.c (tools_actions_update): don't use
action_data_get_context() to update the "tools" action group
because it may return NULL. Use gimp_get_user_context() instead
because the active tool is global regardless of the action group's
context. Fixes accidential tool hiding when closing the last
display.
2004-05-13 Sven Neumann <sven@gimp.org>
* libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save_thumb): oops.
2004-05-13 Michael Natterer <mitch@gimp.org>
Added GimpViewable infrastructure which enables migrating from
TempBuf to GdkPixbuf for both providing and getting previews:
* app/core/gimpviewable.[ch]: added new virtual functions
GimpViewable::get_pixbuf() and GimpViewable::get_new_pixbuf()
which are implemented exactly as get_preview() and
get_new_preview() except that get_new_pixbuf() has a default
implementation which creates the pixbuf from a TempBuf.
Renamed public functions _get_preview_pixbuf() and
_get_new_preview_pixbuf() to _get_pixbuf() and _get_new_pixbuf().
Added gimp_viewable_get_dummy_pixbuf() and use it from
gimp_viewable_get_dummy_preview().
* app/core/gimpimagefile.c (gimp_imagefile_save_thumb)
* app/display/gimpdisplayshell.c (gimp_display_shell_update_icon)
* app/gui/resize-dialog.c (resize_dialog_new): changed accordingly.
2004-05-13 Sven Neumann <sven@gimp.org>
* libgimpthumb/gimpthumbnail.[ch]: added mime-type support.
2004-05-13 Michael Natterer <mitch@gimp.org>
* app/menus/Makefile.am: added file-menu.[ch] and
file-dialog-menu.[ch]
* app/menus/menus.[ch]: removed menus_open_recent_add()...
* app/menus/file-menu.[ch]: ...and added it here as file_menu_setup().
* app/menus/image-menu.c
* app/menus/toolbox-menu.c: changed accordingly.
* app/menus/file-dialog-menu.[ch]: added factored out code from the
file-open and file-save menus as file_dialog_menu_setup().
* app/menus/file-open-menu.c
* app/menus/file-save-menu.c: call file_dialog_menu_setup().
2004-05-12 Michael Natterer <mitch@gimp.org>
* app/actions/documents-actions.c
* app/actions/documents-commands.c
* app/actions/edit-actions.c
* app/actions/edit-commands.[ch]
* app/actions/layers-actions.c
* app/actions/layers-commands.c
* app/actions/select-actions.c
* app/actions/select-commands.[ch]
* app/actions/vectors-actions.c
* app/actions/vectors-commands.[ch]: added tooltips for actions
which are now used for dialog buttons, added callback
implementations which formerly lived in various widgets, moved
some actions around and did some general cleanups.
* menus/image-menu.xml.in: s/edit-stroke/select-stroke/
* menus/Makefile.am
* menus/selection-editor-menu.xml: new popup menu.
* app/menus/menus.c: register <SelectionEditor> and <UndoEditor>
UI managers.
* app/widgets/gimpeditor.[ch]: added construct properties
"menu-factory", "menu-identifier", "ui-path" and "popup-data".
Implement GObject::constructor() and create the UI manager
if all needed properties were set. Enables creating action
buttons at widget construction time because they need a
UI manager.
(gimp_editor_add_action_button): extended to take a va_list of
"extended" actions which are invoked if the resp. button emits
"extended_clicked". Store the actions and their modifier masks in
a list attached to the button.
* app/widgets/gimpcontainerview.c
(gimp_container_view_item_selected): if the view has container
*and* context, simply change the context and return.
(gimp_container_view_context_changed): don't emit "select_item"
manually but simply call gimp_container_view_select_item().
(gimp_container_view_viewable_dropped): use
gimp_container_view_item_selected() instead of changing the
context directly.
* app/widgets/gimpcontainereditor.c
(gimp_container_editor_select_item): update the UI manager.
* app/widgets/gimpdockable.c: don't try to fiddle with the
dialog's menu if it doesn't have a ui_path (happens if the UI
manager is just a collection of actions for the dialog buttons and
has no menu registered).
* app/widgets/gimpimageeditor.c: connect to the image's "flush"
signal and update the UI manager in the callback.
* app/widgets/gimpitemtreeview.c: use GimpEditor's construct
properties to create the UI manager so GimpItemTreeView subclasses
can have action buttons. Update the UI manager in
gimp_item_tree_view_select_item().
* app/widgets/gimpbufferview.c
* app/widgets/gimpcolormapeditor.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpfontview.c
* app/widgets/gimpimageview.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptoolview.c: changed calls to
gimp_editor_add_action_button() accordingly and removed some
unneeded select_item() implementations.
* app/widgets/gimpchanneltreeview.c
* app/widgets/gimpvectorstreeview.[ch]
* app/widgets/gimpdocumentview.[ch]
* app/widgets/gimplayertreeview.c
* app/widgets/gimpselectioneditor.[ch]
* app/widgets/gimpundoeditor.[ch]: use action buttons and removed
lots of callbacks which went to the resp. action callbacks.
* app/widgets/widgets-types.h: removed some now unneeded function
prototypes.
* app/gui/dialogs-constructors.c: changed (simplified) many dialog
constructors accordingly.
2004-05-12 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal)
* app/widgets/gimpwidgets-utils.c (gimp_table_attach_stock):
left-align the label.
* app/actions/channels-commands.c
* app/actions/layers-commands.c
* app/actions/qmask-commands.c
* app/actions/vectors-commands.c
* app/display/gimpdisplayshell-scale.c
* app/gui/brush-select.c
* app/gui/file-new-dialog.c
* app/gui/info-dialog.c
* app/gui/info-window.c
* app/gui/module-browser.c
* app/gui/offset-dialog.c
* app/gui/palette-import-dialog.c
* app/gui/preferences-dialog.c
* app/gui/resize-dialog.c
* app/tools/gimpblendoptions.c
* app/tools/gimpcroptool.c
* app/tools/gimpmeasuretool.c
* app/tools/gimppaintoptions-gui.c
* app/tools/gimpscaletool.c
* app/tools/gimpselectionoptions.c
* app/tools/gimpsheartool.c
* app/tools/gimptextoptions.c
* app/widgets/gimpcolormapeditor.c
* app/widgets/gimpgrideditor.c
* app/widgets/gimphistogrameditor.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpstrokeeditor.c
* app/widgets/gimpwidgets-utils.c: left-align labels as suggested
by the HIG.
2004-05-12 Michael Natterer <mitch@gimp.org>
* app/config/gimpconfig-deserialize.c
* app/config/gimpscanner.c
* app/core/gimp-edit.c
* app/core/gimpchannel-combine.c
* app/core/gimpcontainer.c
* app/core/gimpdrawable-bucket-fill.c
* app/core/gimpdrawable-combine.c
* app/core/gimpdrawable.c
* app/core/gimpgradient.c
* app/core/gimpimage-flip.c
* app/core/gimpimage-merge.c
* app/core/gimpimage-projection.c
* app/core/gimpimage.c
* app/display/gimpdisplay-handlers.c
* app/display/gimpdisplayshell-callbacks.c
* app/display/gimpprogress.c
* app/gui/info-dialog.c
* app/gui/module-browser.c
* app/gui/offset-dialog.c
* app/plug-in/plug-in.c
* app/tools/gimpdrawtool.c
* app/tools/tool_manager.c
* app/widgets/gimpactiongroup.c
* app/widgets/gimpdialogfactory.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpitemfactory.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpwidgets-utils.c
* app/xcf/xcf-save.c
* libgimp/gimpexport.c
* libgimpwidgets/gimphelpui.c
* libgimpwidgets/gimppixmap.c
* libgimpwidgets/gimpunitmenu.c: replaced G_GNUC_FUNCTION,
G_GNUC_PRETTY_FUNCTION, G_STRLOC and hardcoded function names in
g_warning()s by G_STRFUNC.
2004-05-12 Michael Natterer <mitch@gimp.org>
* app/actions/gradients-actions.c
* app/actions/palettes-actions.c
* app/actions/patterns-actions.c: added/fixed tooltips.
2004-05-11 Michael Natterer <mitch@gimp.org>
* configure.in: define G*_DISABLE_DEPRECATED for all G* modules
except GTK+. Don't do so if compiling against GLib, GTK+ >= 2.5.0
and Pango >= 1.5.0
* libgimpwidgets/gimpoffsetarea.c: s/gdk_gc_unref/g_object_unref/
* app/config/gimpconfig-deserialize.c
* app/widgets/gimpdeviceinfo.c:
s/g_value_set_foo_take_ownership/g_value_take_foo/
* app/text/gimptext-vectors.c
* app/text/gimptext-bitmap.c:
s/pango_ft2_font_get_face/pango_fc_font_lock,unlock_face/
2004-05-11 Michael Natterer <mitch@gimp.org>
* app/actions/images-commands.c: added missing #includes.
2004-05-11 Michael Natterer <mitch@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpcontainermenu.[ch]
* app/widgets/gimpcontainermenuimpl.[ch]
* app/widgets/gimpmenuitem.[ch]: removed. Obsoleted by
GimpContainerViewInterface implemented by GimpContainerComboBox.
2004-05-11 Michael Natterer <mitch@gimp.org>
* app/actions/actions.[ch]: added action_data_get_context() and
macro return_if_no_context().
* app/actions/brushes-actions.c
* app/actions/buffers-actions.c
* app/actions/buffers-commands.c
* app/actions/data-commands.c
* app/actions/fonts-actions.c
* app/actions/fonts-commands.c
* app/actions/gradients-actions.c
* app/actions/images-actions.c
* app/actions/images-commands.c
* app/actions/palettes-actions.c
* app/actions/patterns-actions.c
* app/actions/templates-actions.c
* app/actions/templates-commands.[ch]
* app/actions/tools-actions.c
* app/actions/tools-commands.c: moved lots of code from widgets/
to the resp. action callbacks.
* app/widgets/gimpeditor.[ch]: added gimp_editor_add_action_button()
which creates a GtkButton connected to the resp. action.
* app/widgets/gimpdatafactoryview.[ch]: added "action_group"
parameters so we can distinguish brushes, patterns etc. actions.
* app/widgets/gimpimageview.[ch]
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpfontview.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimptemplateview.[ch]
* app/widgets/gimptoolview.c: removed tons of GtkButton::clicked()
callbacks and use gimp_editor_add_action_button() instead
of simply _add_button().
* app/gui/dialogs-constructors.c
* app/gui/gradient-select.c
* app/gui/palette-select.c
* app/gui/pattern-select.c: changed accordingly.
2004-05-11 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpcontainercombobox.c: correctly get the default
GimpContainerViewInterface implementation and chain up to it for
clear_items(). Update the preview renderers on "update", enable
deselecting everything.
* app/widgets/gimpimagedock.[ch]
* app/gui/file-new-dialog.c
* app/gui/palette-import-dialog.c
* app/gui/preferences-dialog.c
* app/gui/stroke-dialog.c: use GimpContainerComboBox instead of
GimpContainerMenuImpl.
* app/gui/palette-import-dialog.c: cleanup.
2004-05-11 Sven Neumann <sven@gimp.org>
* docs/gimptool.1.in: fixed spelling.
2004-05-11 Sven Neumann <sven@gimp.org>
* app/widgets/gimpcontainertreeview.c: minor cleanup.
2004-05-11 Michael Schumacher <schumaml@cvs.gnome.org>
* libgimp/gimp.def
* libgimpbase/gimpbase.def: updated
2004-05-11 Sven Neumann <sven@gimp.org>
* app/gui/user-install-dialog.c: removed the "Aborting
Installation" page. We added it as a nice little gimmick but
obviously people don't understand it's purpose. Fixes bug #142281.
2004-05-11 Sven Neumann <sven@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpcontainercombobox.[ch]: added new widget, almost
finished.
* app/widgets/gimpcontainerview.[ch]: added convenience functions
to get and set the GimpContainerView properties.
* app/widgets/gimpcontainerbox.c: use the convenience functions.
* app/gui/file-new-dialog.c: use the new GimpContainerComboBox.
* etc/templaterc: use "pixels" as the unit for pixel sized templates.
2004-05-11 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpchanneltreeview.c
* app/widgets/gimpcontainerbox.[ch]
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainergridview.[ch]
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview.[ch]
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpdocumentview.c
* app/widgets/gimpfontview.c
* app/widgets/gimpimageview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimptemplateview.c
* app/widgets/gimpvectorstreeview.c: code review / cleanup.
2004-05-11 Michael Natterer <mitch@gimp.org>
* app/widgets/widgets-types.h
* app/widgets/gimpcontainerview.[ch]: made GimpContainerView an
interface. Added accessors for all members in the private struct
and made it really private.
* app/widgets/gimpcontainerbox.[ch]: derive it from GimpEditor and
implement GimpContainerViewInterface and its properties.
* app/widgets/gimpchanneltreeview.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpdrawabletreeview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpvectorstreeview.c: implement
GimpContainerViewInterface and use the new accessor functions.
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpdocumentview.c: changed accordingly.
* app/widgets/gimptemplateview.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpundoeditor.c
* app/actions/palettes-commands.c: #include "gimpcontainerview.h"
2004-05-11 Sven Neumann <sven@gimp.org>
* libgimp/gimp.def
* libgimp/gimpui.def
* libgimpbase/gimpbase.def
* libgimpwidgets/gimpwidgets.def: updated.
2004-05-10 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpframe.c (gimp_frame_style_set): removed a
redundant call to gtk_widget_queue_resize().
2004-05-10 Sven Neumann <sven@gimp.org>
* app/xcf/xcf-save.c (xcf_save_prop): fixed size of colormap
property. Patch by Daniel Kobras, fixes bug #142149.
2004-05-10 Henrik Brix Andersen <brix@gimp.org>
* plug-ins/common/screenshot.c (shoot_dialog): fixed the spacing
of the dialog, thanks to Sven for pointing out my mistake.
2004-05-10 Sven Neumann <sven@gimp.org>
* app/widgets/gimptexteditor.c (gimp_text_editor_set_direction):
don't call gtk_widget_set_direction() on a non-existant widget.
Fixes bug #141792.
2004-05-10 Sven Neumann <sven@gimp.org>
* app/gui/tips-dialog.c: added missing newline in error message.
2004-05-10 Michael Natterer <mitch@gimp.org>
More GimpContainerView chopping:
* app/widgets/gimpcontainerview.[ch]: added
GimpContainerViewPrivate struct (which is currently public :-) and
removed all members from the GimpContainerView struct. Added
accessors for "context", "container" and "preview_size /
preview_border_width". Added macro to get the private struct
(*not* via G_TYPE_INSTANCE_GET_PRIVATE because that's unavailable
for interfaces).
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpchanneltreeview.c
* app/widgets/gimpcontainerbox.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpcontainertreeview-dnd.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpdatafactoryview.c
* app/widgets/gimpdocumentview.c
* app/widgets/gimpfontview.c
* app/widgets/gimpimageview.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimpsessioninfo.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptoolview.c
* app/actions/brushes-actions.c
* app/actions/buffers-actions.c
* app/actions/dockable-actions.c
* app/actions/dockable-commands.c
* app/actions/documents-actions.c
* app/actions/fonts-actions.c
* app/actions/gradients-actions.c
* app/actions/gradients-commands.c
* app/actions/images-actions.c
* app/actions/palettes-actions.c
* app/actions/palettes-commands.c
* app/actions/patterns-actions.c
* app/actions/templates-actions.c
* app/actions/tools-actions.c
* app/actions/tools-commands.c: changed accordingly.
2004-05-10 Sven Neumann <sven@gimp.org>
* app/tools/gimpmagnifyoptions.[ch]
* app/tools/gimpmagnifytool.c: applied a patch from William Skaggs
that changes a misleading option label. Fixes bug #137508.
2004-05-10 Sven Neumann <sven@gimp.org>
* app/config/gimpdisplayconfig.c (DEFAULT_IMAGE_TITLE_FORMAT):
removed the display scale from the default image title because
it's now displayed in the statusbar. Show the image pixel size
instead.
* app/gui/preferences-dialog.c: include a preset for the title
format string that shows the image size (bug #141720).
2004-05-10 Michael Natterer <mitch@gimp.org>
Prepare for making an interface out of GimpContainerView:
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpcontainerbox.[ch]: new GimpContainerView
subclass which implements GimpDocked interface and contains the
vbox-with-scrolled-window stuff common to GimpContainerGridView
and GimpContainerTreeView.
* app/widgets/gimpcontainerview.[ch]: removed that functionality
here.
* app/widgets/gimpcontainergridview.[ch]
* app/widgets/gimpcontainertreeview.[ch]: derive them from
GimpContainerBox.
* app/gui/brush-select.c
* app/gui/font-select.c
* app/gui/gradient-select.c
* app/gui/palette-select.c
* app/gui/pattern-select.c
* app/widgets/gimpcontainerpopup.c: changed accordingly.
2004-05-10 Sven Neumann <sven@gimp.org>
* app/actions/view-actions.c: added a stock icon for "view-zoom-1-1".
* app/widgets/gimpunitcombobox.[ch]: added functions to get and
set the active unit.
* app/widgets/gimpunitstore.c (gimp_unit_store_tree_model_get_value):
need to special case GIMP_UNIT_PIXEL.
* app/display/Makefile.am
* app/display/display-types.h
* app/display/gimpscalecombobox.[ch]: new widget to be used in the
display's statusbar.
* app/display/gimpdisplayshell-cursor.[ch]: always display the
cursor position, not only if the cursor is inside the image. Added
new function gimp_display_shell_clear_cursor() to clear the cursor
label.
* app/display/gimpdisplayshell-callbacks.c: changed accordingly.
* app/display/gimpstatusbar.[ch]
* app/display/gimpdisplayshell.c
* app/display/gimpdisplayshell-handlers.c
* app/display/gimpdisplayshell-scale.c: do not explicitely resize
the statusbar cursor label, connect to GimpDisplayShell::scaled
instead. Added a GimpScaleComboBox to the status bar.
2004-05-10 Michael Natterer <mitch@gimp.org>
Started making the toolbox configurable.
Addresses bug #105764. Not finished yet.
* app/core/gimptoolinfo.[ch]: renamed "in_toolbox" to "visible"
and made it a GObject property.
* app/tools/gimp-tools.[ch]: added new function
gimp_tools_get_default_order() which returns a GList of tool
identifiers.
* app/actions/tools-actions.c
* app/actions/tools-commands.[ch]: added actions & callbacks for
toggling the "visible" boolean and for resetting all tools.
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimptoolview.[ch]: new widget which allows to
toggle a tool's visibility and to reorder the tools.
* app/widgets/gimptoolbox.[ch]: removed member "GtkWidget *trash"
and pack all tool buttons into the same wrap box. Connect to
"reoder" of the tool container and to "notify::visible" of all
tool infos and update the toolbox accordingly.
* app/gui/dialogs-constructors.c: create a GimpToolView for the
tools list/grid.
* app/menus/menus.c: register a <Tools> menu for the dialog above.
* menus/Makefile.am
* menus/tools-menu.xml: added the menu.
2004-05-10 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpuimanager.c: re-added help for menu items. Still
incomplete because there is no fallback help ID yet when pressing
F1 over a menu item which has a submenu. Added evil workaround and
version check for signal brokenness of GtkUIManager in GTK+ 2.4.1.
2004-05-09 Hans Breuer <hans@breuer.org>
Merge from stable branch :
* plug-ins/common/winclipboard.c : support gray images;
fixes bug #141382
* plug-ins/common/winprint.c : dito; fixes bug #141145
2004-05-09 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/common/aa.c
* plug-ins/common/apply_lens.c
* plug-ins/common/autocrop.c
* plug-ins/common/autostretch_hsv.c: HIGified, GPL license added in
some plug-ins, minor code clean-up.
2004-05-08 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/common/spread.c: HIGified, simplified and fixes #141733
2004-05-08 Henrik Brix Andersen <brix@gimp.org>
* plug-ins/common/screenshot.c (shoot_dialog): HIGify the
screenshot plug-in. Fixes part of bug #141772.
2004-05-08 Sven Neumann <sven@gimp.org>
* app/display/gimpstatusbar.c (gimp_statusbar_resize_cursor):
added 1 pixel horizontal padding around the label.
2004-05-08 Sven Neumann <sven@gimp.org>
* app/display/gimpstatusbar.[ch]: renamed struct member combo to
unit_combo. Place the combobox into the cursor frame.
2004-05-08 Sven Neumann <sven@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpunitcombobox.[ch]
* app/widgets/gimpunitstore.[ch]: added a prototype of a unit menu
based on GtkComboBox. Will move this to libgimpwidgets later...
* app/display/gimpstatusbar.[ch]: use the new GimpUnitComboBox and
GimpUnitStore.
* themes/Default/gtkrc
* themes/Small/gtkrc: hardcode the appearance of the
GimpUnitComboBox. It uses a hack that doesn't work in list mode.
2004-05-07 Sven Neumann <sven@gimp.org>
* app/core/gimpimage-colormap.[ch]: added a const qualifier.
Changed how the image unit and dot-for-dot mode is handled. Might
break things and certainly needs more changes (mainly in tools):
* app/core/gimptemplate.c: allow GIMP_UNIT_PIXEL as image unit.
* app/display/gimpdisplayshell-handlers.c
* app/display/gimpdisplayshell-scale.c
* app/display/gimpdisplayshell-title.c
* app/display/gimpstatusbar.c: always use the image unit for the
rulers and to display lengths.
* app/widgets/gimptemplateeditor.c: redone GimpTemplateEditor
based on a dialog mockup from Jimmac and Tigert.
* app/core/core-enums.[ch]: changed some descriptions used by the
template editor.
2004-05-07 Michael Natterer <mitch@gimp.org>
* plug-ins/common/AlienMap2.c
* plug-ins/common/CML_explorer.c
* plug-ins/common/animationplay.c
* plug-ins/common/despeckle.c
* plug-ins/fp/fp.c
* plug-ins/gfig/gfig.c
* plug-ins/gflare/gflare.c
* plug-ins/script-fu/script-fu.c
* plug-ins/twain/twain.c: forgot some gimp_plugin_menu_register().
2004-05-07 Michael Natterer <mitch@gimp.org>
* plug-ins/FractalExplorer/FractalExplorer.c
* plug-ins/Lighting/lighting_main.c
* plug-ins/MapObject/mapobject_main.c
* plug-ins/dbbrowser/dbbrowser.c
* plug-ins/flame/flame.c
* plug-ins/gimpressionist/gimp.c
* plug-ins/ifscompose/ifscompose.c
* plug-ins/imagemap/imap_main.c
* plug-ins/maze/maze.c
* plug-ins/pagecurl/pagecurl.c
* plug-ins/print/print.c
* plug-ins/rcm/rcm.c
* plug-ins/winsnap/winsnap.c
* plug-ins/common/[g-z]*.c: use gimp_plugin_menu_register(). Some
formatting cleanups in some query() functions.
2004-05-07 Michael Natterer <mitch@gimp.org>
* app/plug-in/plug-in-proc.[ch]: removed member "accelerator".
It was never set and this is the conceptually wrong place to store
it anyway.
* app/actions/file-dialog-actions.c
* app/actions/plug-in-actions.c
* app/plug-in/plug-in-message.c
* app/xcf/xcf.c: changed accordingly.
* tools/pdbgen/pdb/plug_in.pdb (plugins_query): always return NULL
as accelerator. Cleaned up the function a bit and made it aware of
proc_def->menu_label added below.
* app/pdb/plug_in_cmds.c: regenerated.
2004-05-07 Michael Natterer <mitch@gimp.org>
Changed plug-in menu registration again to allow passing just the
menu item's label (not the full path) in gimp_install_procedure()
and only the path (excluding the item's label) in
gimp_plugin_menu_register(). Matches the internal action system
better and makes translating the menu paths much easier.
(Of yourse it's still possible to use the old syntax for backward
compatibility).
* app/plug-in/plug-in-proc.[ch]: added "gchar *menu_label".
* app/plug-in/plug-in-params.[ch]: added new functions
plug_in_param_defs_check() and plug_in_proc_args_check() which
check if a procedure's parameters match its menu location
(e.g. <Image> needs RUN-MODE, IMAGE, DRAWABLE).
* app/plug-in/plug-in-message.c (plug_in_handle_proc_install): if
registering an old-style (full) menu_path, use
plug_in_param_defs_check(), set proc_def->menu_label otherwise.
* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): use
plug_in_proc_args_check() on the passed menu_path and make sure
old and new style menu registration are not mixed.
* app/pdb/plug_in_cmds.c: regenerated.
* app/plug-in/plug-in-rc.c: save/restore "menu_label".
* app/actions/file-dialog-actions.c
* app/actions/plug-in-actions.c
* app/menus/plug-in-menus.c: changed action/menu creation
accordingly. Some hacks needed to allow both old and new style
menu_label/menu_paths.
* app/plug-in/plug-in.c
* app/widgets/gimpfiledialog.c
* app/xcf/xcf.c: changed accordingly.
* plug-ins/common/align_layers.c
* plug-ins/common/animationplay.c
* plug-ins/common/animoptimize.c
* plug-ins/common/apply_lens.c
* plug-ins/common/autocrop.c
* plug-ins/common/autostretch_hsv.c
* plug-ins/common/blinds.c
* plug-ins/common/blur.c
* plug-ins/common/borderaverage.c
* plug-ins/common/bumpmap.c
* plug-ins/common/c_astretch.c
* plug-ins/common/ccanalyze.c
* plug-ins/common/channel_mixer.c
* plug-ins/common/checkerboard.c
* plug-ins/common/color_enhance.c
* plug-ins/common/colorify.c
* plug-ins/common/colortoalpha.c
* plug-ins/common/compose.c
* plug-ins/common/convmatrix.c
* plug-ins/common/cubism.c
* plug-ins/common/curve_bend.c
* plug-ins/common/decompose.c
* plug-ins/common/deinterlace.c
* plug-ins/common/depthmerge.c
* plug-ins/common/destripe.c
* plug-ins/common/diffraction.c
* plug-ins/common/displace.c
* plug-ins/common/edge.c
* plug-ins/common/emboss.c
* plug-ins/common/engrave.c
* plug-ins/common/exchange.c
* plug-ins/common/film.c
* plug-ins/common/flarefx.c
* plug-ins/common/fractaltrace.c
* plug-ins/common/screenshot.c: ported the first few plug-ins
to the new registration scheme.
2004-05-06 Manish Singh <yosh@gimp.org>
* tools/pdbgen/pdb/app.pl: make libgimp* headers always included
before any app headers.
* tools/pdbgen/pdb/paint_tools.pdb: Fix silly "Dodgebure" typo.
* app/pdb/*_cmds.c: regenerated.
2004-05-06 Sven Neumann <sven@gimp.org>
* app/core/gimpdrawable-preview.c
* app/core/gimpimage-projection.c: added sanity so we don't just
plain crash when an indexed image doesn't have a colormap.
* plug-ins/common/png.c: keep at least one entry in the colormap.
Fixes bug #142029.
2004-05-06 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/common/sobel.c: replaced RMS macro by smarter one,
resulting in a doubling in speed for this plug-in.
* plug-ins/fp/fp.c: include stdlib for free, malloc and abs.
2004-05-06 Maurits Rijk <m.rijk@chello.nl>
* plug-ins/fp/fp_gdk.c
* plug-ins/fp/fp_gtk.c
* plug-ins/fp/fp_misc.c
* plug-ins/fp/fp.h: removed
* plug-ins/fp/Makefile.am: changed accordingly
* plug-ins/fp/fp.c: merged into one single file to get rid of all
global variables and functions. Major clean-up. Still more to come.
2004-05-06 Sven Neumann <sven@gimp.org>
* app/gui/about-dialog.c: center the about dialog on the monitor,
not on the screen. Fixes window position on xinerama setups.
2004-05-06 Michael Natterer <mitch@gimp.org>
* tools/pdbgen/pdb/plug_in.pdb: renamed gimp_plugin_menu_add() to
gimp_plugin_menu_register() for consistency with other
gimp_plugin_foo_register() functions which can be called during
query().
* app/pdb/plug_in_cmds.c
* libgimp/gimpplugin_pdb.[ch]: regenerated.
* plug-ins/common/ccanalyze.c
* plug-ins/common/colortoalpha.c
* plug-ins/common/screenshot.c
* plug-ins/winsnap/winsnap.c: changed accordingly.
2004-05-06 Michael Natterer <mitch@gimp.org>
Enabled multiple menu entries per plug-in procedure:
* app/plug-in/plug-in-proc.[ch]: changed "gchar *menu_path" to
"GList *menu_paths".
* app/plug-in/plug-in-message.c
* app/plug-in/plug-in-rc.c
* app/plug-in/plug-in.c
* app/plug-in/plug-ins.c
* app/menus/menus.c
* app/widgets/gimpfiledialog.c
* app/xcf/xcf.c: changed accordingly.
* app/actions/file-dialog-actions.c
* app/actions/plug-in-actions.c: create an action for the first
element of proc_def->menu_paths.
* app/gui/gui-vtable.c
* app/menus/plug-in-menus.[ch]: create proxy widgets for each
element of proc_def->menu_paths.
* tools/pdbgen/pdb/plug_in.pdb: added new function
gimp_plugin_menu_add() which can be called during query() and adds
a menu path to a procedure registered by the calling plugin.
* app/pdb/internal_procs.c
* app/pdb/plug_in_cmds.c
* libgimp/gimpplugin_pdb.[ch]: regenerated.
* menus/image-menu.xml.in
* menus/toolbox-menu.xml.in: added lots of <placeholder>s for
logical groups (like Image/Resize, Image/Scale, Image/Crop
etc.). Added empty placeholder File/Send for stuff like print and
mail. Added an "Acquire" menu under <Image>/File
* plug-ins/common/mail.c
* plug-ins/print/print.c
* plug-ins/common/winprint.c: register under File/Send.
* plug-ins/common/screenshot.c
* plug-ins/winsnap/winsnap.c: also register under
<Image>/File/Acquire.
* plug-ins/common/autocrop.c
* plug-ins/common/ccanalyze.c
* plug-ins/common/colortoalpha.c
* plug-ins/common/threshold_alpha.c
* plug-ins/common/zealouscrop.c: register additional menu entries
under placeholders in the "Image" and "Layer" menus. This is not
meant to be final but just a hint to keep in mind when
reorganizing the plug-in menus.
2004-05-06 Sven Neumann <sven@gimp.org>
* app/gui/resize-dialog.[ch]: cleaned up variable names and
external API. Still quite a mess.
* app/Makefile.am
* app/actions/image-commands.c
* app/actions/layers-commands.c: changed accordingly.
2004-05-06 Sven Neumann <sven@gimp.org>
* app/menus/menus.c: no need for including gimp-intl.h.
2004-05-06 Michael Natterer <mitch@gimp.org>
* configure.in
* app/Makefile.am
* app/menus/.cvsignore
* app/menus/Makefile.am
* app/menus/menus-types.h
* app/menus/menus.[ch]
* app/menus/file-open-menu.[ch]
* app/menus/file-save-menu.[ch]
* app/menus/image-menu.[ch]
* app/menus/plug-in-menus.[ch]
* app/menus/tool-options-menu.[ch]
* app/menus/toolbox-menu.[ch]: moved all menus files to their
own directory.
* app/gui/Makefile.am
* app/gui/menus.[ch]
* app/gui/file-open-menu.[ch]
* app/gui/file-save-menu.[ch]
* app/gui/image-menu.[ch]
* app/gui/plug-in-menus.[ch]
* app/gui/tool-options-menu.[ch]
* app/gui/toolbox-menu.[ch]: removed them here.
* app/actions/debug-commands.c
* app/actions/file-commands.c
* app/gui/brush-select.c
* app/gui/dialogs.c
* app/gui/font-select.c
* app/gui/gradient-select.c
* app/gui/gui-vtable.c
* app/gui/gui.c
* app/gui/palette-select.c
* app/gui/pattern-select.c
* app/gui/preferences-dialog.c: changed #includes accordingly.
2004-05-05 Sven Neumann <sven@gimp.org>
* app/gui/file-new-dialog.c: use a normal GimpDialog instead of a
GimpViewableDialog that never has a viewable set.
2004-05-05 Michael Natterer <mitch@gimp.org>
* app/gui/brush-select.[ch] (brush_select_new): reordered parameters
so the first four are the same for all foo_select_new() functions.
* tools/pdbgen/pdb/brush_select.pdb: changed accordingly.
* app/pdb/brush_select_cmds.c: regenerated.
* app/gui/font-select.c (font_select_new): set the vbox'
border width to 6 to match the other foo_select dialogs.
2004-05-05 Michael Natterer <mitch@gimp.org>
* app/actions/debug-actions.c
* app/actions/debug-commands.[ch]
* menus/toolbox-menu.xml.in: added action & callback which XML-dump
all UI managers.
2004-05-05 Michael Natterer <mitch@gimp.org>
* app/actions/plug-in-actions.c (plug_in_actions_add_proc): fixed
bug which would have leaked broken menu translations.
* app/gui/plug-in-menus.c: removed useless #includes.
2004-05-05 Michael Natterer <mitch@gimp.org>
* app/actions/file-actions.c
* app/actions/file-commands.[ch]: remove "file-close" action and
callback...
* app/actions/view-actions.c
* app/actions/view-commands.[ch]: ...and added it here as
"view-close" because that's what it does.
* app/actions/qmask-actions.c
* app/actions/qmask-commands.c: s/QMask/QuickMask/g
* app/gui/menus.c: add the "channels" action group to the <Image>
and <Dock> UI managers, renamed UI manager <Dialogs> to
<Dockable>.
* app/widgets/gimpdockbook.c: s/<Dialogs>/<Dockable>/.
* menus/image-menu.xml.in: s/file-close/view-close/, added
separators at the end of most menus, moved the bottom group of the
"View" menu after the zoom group.
2004-05-05 Michael Natterer <mitch@gimp.org>
* app/actions/select-actions.c: removed action "select-by-color".
* app/tools/gimpbycolorselecttool.c: add the shortcut here.
* app/actions/tools-actions.c: added alternative tool actions for
"by-color-select" and "rotate" which are identical to the ones
generated from the GimpToolInfo except for their label. Make sure
they have the same accelerators as the generated ones.
* menus/image-menu.xml.in: use the alternative actions for
"<Image>/Select/By Color" and
"<Layer>/Transform/Arbitrary Rotation...".
2004-05-05 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimphelpui.c: documentation.
2004-05-05 Michael Natterer <mitch@gimp.org>
Finally enable global accelerators in all docks:
* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
iterate all of the UI manager's actions and enable their
accelerators manually. Fixes bug #119878.
2004-05-05 Sven Neumann <sven@gimp.org>
* app/widgets/gimpviewabledialog.c: added construct properties to
make it possible to derive from GimpViewableDialog.
* app/widgets/gimptooldialog.[ch]: make GimpToolDialog a real
object, not just a convenience constructor.
* themes/Default/gtkrc
* themes/Small/gtkrc: set a smaller border_width of 6 pixels for
the action area of tool dialogs.
* app/tools/gimpcolorpickertool.c
* app/tools/gimpimagemaptool.c: set a smaller border_width of 6
pixels on tool dialogs to make them more compact.
2004-05-05 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimpoffsetarea.[ch]: added new function
gimp_offset_area_set_pixbuf(). Started to clean up the
code a bit.
* app/gui/resize-dialog.c (resize_widget_new): use the new feature
and set a preview of the image. Fixes bug #78733.
2004-05-05 Sven Neumann <sven@gimp.org>
* app/gui/info-dialog.c
* app/tools/gimpcolorbalancetool.c
* app/tools/gimpcolorizetool.c
* app/tools/gimpcurvestool.c
* app/tools/gimphuesaturationtool.c
* app/tools/gimpimagemaptool.c
* app/tools/gimplevelstool.c: use GimpFrame widgets, changed spacings.
* app/widgets/gimptexteditor.c: tweaked.
2004-05-05 Jakub Steiner <jimmac@ximian.com>
* data/images/gimp_splash.png: ustable splash
2004-05-04 Michael Natterer <mitch@gimp.org>
* app/gui/menus.c: register a <Dock> UI manager which has all
action groups <Image> has except "view".
* app/widgets/gimpimagedock.[ch]: re-enabled the global shortcuts,
using UI manager instead of item factory. Unfortunately actions
without proxy widgets can't be activated so this change is pretty
useless. Oh well, will find a hack to work around this later...
2004-05-04 Sven Neumann <sven@gimp.org>
* app/tools/gimpblendoptions.c
* app/tools/gimpbucketfilloptions.c
* app/tools/gimpcoloroptions.c
* app/tools/gimpinkoptions.c
* app/tools/gimppaintoptions-gui.c
* app/tools/gimpselectionoptions.c
* app/tools/gimptooloptions-gui.c
* app/tools/gimptransformoptions.c: use GimpFrames where GtkFrame
was used. Put "Pressure Sensitivity" frame into a GtkExpander.
2004-05-04 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpframe.c: added a style property to control
boldening of the frame title.
* themes/Default/gtkrc
* themes/Small/gtkrc: suppress the bold title for GimpFrames in
GimpDockables,
2004-05-04 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): allocate
the full width for the label widget, looks better and is more
convenient to use with activatable widgets such as toggle buttons.
2004-05-04 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpfiledialog.c: removed debugging output, added
#warning about runtime version check that can be removed as soon
as we depend on GTK+ 2.4.1.
2004-05-04 Michael Natterer <mitch@gimp.org>
* app/actions/file-dialog-actions.c (file_dialog_actions_setup):
don't forget to set the action's accelerator.
2004-05-04 Sven Neumann <sven@gimp.org>
* app/actions/channels-commands.c
* app/actions/gradient-editor-commands.c
* app/actions/image-commands.c
* app/actions/layers-commands.c
* app/actions/qmask-commands.c
* app/actions/templates-commands.c
* app/actions/vectors-commands.c
* app/display/gimpdisplayshell-filter-dialog.c
* app/gui/convert-dialog.c
* app/gui/module-browser.c
* app/gui/offset-dialog.c
* app/gui/palette-import-dialog.c
* app/gui/resize-dialog.c
* app/gui/resolution-calibrate-dialog.c
* app/gui/tips-dialog.c
* app/gui/user-install-dialog.c
* app/widgets/gimpwidgets-utils.c
* libgimpwidgets/gimpquerybox.c: set dialog border spacing to 12.
2004-05-04 Sven Neumann <sven@gimp.org>
* app/gui/preferences-dialog.c
* app/widgets/widgets-enums.[ch]
* app/widgets/gimpwidgets-utils.c (gimp_window_set_hint): added
new window hint "keep-above" to force toolbox and/or dock windows
to be kept above (if the WM supports this hint). Fixes bug #131672.
2004-05-04 Michael Natterer <mitch@gimp.org>
Fix bug #141719:
* app/tools/gimpmovetool.c (gimp_move_tool_motion): use RINT()
instead of ROUND() to round double coords to guide positions.
* app/display/gimpdisplayshell-callbacks.c
(gimp_display_shell_canvas_tool_events): pass RINT()-rounded
coords to gimp_display_shell_update_cursor() instead of implicitly
truncating by casting to int.
2004-05-04 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpundoeditor.c: removed code duplication by adding
utility function gimp_undo_editor_update_buttons(), some general
cleanups.
2004-05-04 Michael Natterer <mitch@gimp.org>
* app/core/gimpimage.c (gimp_image_undo_freeze,thaw): emit the
"undo-freeze" and "undo-thaw" signals only on the first freeze and
last thaw, not on any of them.
* app/widgets/gimphelp-ids.h: added GIMP_HELP_EDIT_UNDO_CLEAR.
* app/widgets/gimpundoeditor.[ch]: added a "Clear Undo History"
button. Fixes bug #136300.
Also don't attach to the image's undo stack if the image's undo is
disabled and set the buttons' sensitivity accordingly. Should fix
all kinds of unpredictable undo history brokenness.
2004-05-04 Michael Natterer <mitch@gimp.org>
Treat FG/BG just like all other context properties:
* app/paint/gimppaintoptions.h: added GIMP_CONTEXT_FOREGROUND_MASK
and _BACKGROUND_MASK to GIMP_PAINT_OPTIONS_CONTEXT_MASK to specify
that they are used by GimpPaintOptions (automatically affects all
paint tools).
* app/tools/gimpblendtool.c
* app/tools/gimpbucketfilltool.c
* app/tools/gimpinktool.c: set FOREGROUND_MASK and BACKGROUND_MASK
manually here.
* app/tools/tool_manager.c (tool_manager_tool_changed): decide
about the globality of FG and BG at the same place where we decide
about the brush's, pattern's etc. globality, but hardcode them to
global = TRUE instead of looking at GimpConfig.
Fixes bug #141786.
2004-05-04 Sven Neumann <sven@gimp.org>
* plug-ins/common/sobel.c (sobel_dialog): removed frame, adjusted
spacing, fixes bug #141773.
2004-05-04 Sven Neumann <sven@gimp.org>
* app/gui/stroke-dialog.c:
* app/widgets/gimpstrokeeditor.c: moved line style options into a
GtkExpander. Changed dialog spacings.
2004-05-03 Manish Singh <yosh@gimp.org>
* app/actions/qmask-actions.c: initialize is_active for qmask-toggle.
* app/actions/tools-actions.c: set entry help_id from tool_info,
since gimp_action_group_add_string_actions expects it to be there
now.
2004-05-03 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpframe.c (gimp_frame_new): added a hack that
allows to get the label_spacing but no label. Useful when the frame
is packed into a GtkExpander.
* app/widgets/gimptemplateeditor.c: pack the "Image Comment" frame
into a GtkExpander to reduce clutter and dialog size.
2004-05-03 Michael Natterer <mitch@gimp.org>
* libgimpwidgets/gimphelpui.[ch]: added gimp_help_id_quark()
which is G_GNUC_CONST and a new macro GIMP_HELP_ID as shortcut.
* app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions):
attach the help ID to the action using the new quark key. Call
gtk_action_group_add_action() instead of the _with_accel() variant
if the accel is the empty string (== if we explicitely want no
accel even if the stock item specifies one). Fixes warning flood
with GTK+ 2.4.1.
2004-05-03 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpframe.c: if the label_widget is a button, set
the button label as bold. Cache the indentation instead of
calculating it over and over again.
* themes/Default/gtkrc: set HIG-compliant spacing for the
action_area.
* app/widgets/gimppropwidgets.[ch]: added
gimp_prop_enum_radio_box_new() for a radio group that is no
embedded in a frame.
* app/widgets/gimpstrokeeditor.c: use a frame-less radio box for
the Stroke style.
* app/gui/file-new-dialog.c
* app/gui/grid-dialog.c
* app/gui/stroke-dialog.c: HIG-compliant spacings.
2004-05-03 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdock.c (gimp_dock_key_press_event): new function
which overrides GtkWindow's default handler in order to give the
focus widget precedence over accelerators for keys without any
modifier or with <Shift> modifier. Enables e.g. having a <Shift>+s
accelerator while still being able to enter 'S' in an entry.
Thanks to Tim Janik for the code.
2004-05-03 Michael Natterer <mitch@gimp.org>
* app/actions/actions.h. added the various return_if_no_foo()
macros here.
* app/actions/channels-commands.c
* app/actions/dialogs-commands.c
* app/actions/drawable-commands.c
* app/actions/edit-commands.c
* app/actions/file-commands.c
* app/actions/image-commands.c
* app/actions/layers-commands.c
* app/actions/qmask-commands.c
* app/actions/select-commands.c
* app/actions/vectors-commands.c
* app/actions/view-commands.c: removed them here. Some cleanup.
2004-05-03 Michael Natterer <mitch@gimp.org>
* app/actions/actions.[ch]: added some utility functions to get a
Gimp, GimpImage, GimpDisplay and GtkWidget from the "data" pointer
passed to action callbacks.
* app/actions/channels-actions.c
* app/actions/channels-commands.c
* app/actions/drawable-actions.c
* app/actions/drawable-commands.c
* app/actions/edit-actions.c
* app/actions/edit-commands.c
* app/actions/file-actions.c
* app/actions/file-commands.c
* app/actions/help-commands.c
* app/actions/image-actions.c
* app/actions/image-commands.c
* app/actions/layers-actions.c
* app/actions/layers-commands.c
* app/actions/plug-in-actions.c
* app/actions/plug-in-commands.c
* app/actions/qmask-actions.c
* app/actions/qmask-commands.c
* app/actions/select-actions.c
* app/actions/select-commands.c
* app/actions/tools-commands.c
* app/actions/vectors-actions.c
* app/actions/vectors-commands.c
* app/actions/view-commands.c: use the new functions instead of
duplicating insane macros and if() constructs over and over again.
2004-05-03 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpwidgets.c: use a GimpFrame for
gimp_radio_group_new() and friends.
* themes/Default/gtkrc
* themes/Small/gtkrc: set a smaller label_spacing for GimpFrame
widgets in GimpDockables. Lame hack to keep the tool options
compact.
* app/actions/image-commands.c: changed spacing.
* app/gui/offset-dialog.c: merged check and radio buttons into a
single radio button group; changed spacing.
2004-05-03 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): respect
the frame's border width.
* app/widgets/gimpcolorframe.[ch]: derive from GimpFrame.
* app/gui/convert-dialog.c
* app/gui/info-window.c
* app/gui/palette-import-dialog.c
* app/gui/resize-dialog.c: use GimpFrames, changed some spacings.
2004-05-03 Michael Natterer <mitch@gimp.org>
* app/actions/dockable-commands.c (dockable_add_tab_cmd_callback):
truncate the passed dialog identifier at the first '|'. Fixes
creating brushes, paterns etc. dialogs from the dockables'
"Add Tab" menu.
2004-05-02 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpframe.c (gimp_frame_size_request): take the
left margin into account.
* app/widgets/gimpgrideditor.c
* app/widgets/gimptemplateeditor.c: removed container borders that
aren't needed any longer.
2004-05-02 Sven Neumann <sven@gimp.org>
* app/widgets/gimpenumwidgets.c
* app/widgets/gimpgrideditor.c
* app/widgets/gimptemplateeditor.c: use the GimpFrame widget,
changed some spacings to better comply with the HIG.
2004-05-02 Sven Neumann <sven@gimp.org>
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpwidgets.h
* libgimpwidgets/gimpwidgetstypes.h
* libgimpwidgets/gimpframe.[ch]: added new widget GimpFrame, a HIG
compliant variant of GtkFrame.
* app/gui/preferences-dialog.c: enable the HIG compliant mode by
default and use the new GimpFrame widget for it.
* themes/Small/gtkrc: set a smaller spacing between the GimpFrame
title label and the frame content.
2004-05-02 Michael Natterer <mitch@gimp.org>
* app/actions/qmask-actions.c: renamed action "qmask-toggle" to
"qmask-active" and added new action "qmask-toggle" with a label
and shortcut suited for the "Select" menu.
* app/actions/select-actions.c: removed "select-toggle-qmask".
* app/actions/select-commands.[ch]: removed callback
select_toggle_quickmask_cmd_callback().
* app/actions/channels-actions.c (channels_actions_update)
* app/actions/vectors-actions.c (vectors_actions_update): handle
"data" being both GimpDisplay and GimpDisplayShell so the actions
can be used in the image menu.
* menus/image-menu.xml.in: s/select-toggle-qmask/qmask-toggle/.
* menus/qmask-menu.xml: s/qmask-toggle/qmask-active/.
2004-05-02 Sven Neumann <sven@gimp.org>
* menus/image-menu.xml.in
* menus/tool-options-menu.xml
* menus/toolbox-menu.xml.in: use empty elements for empty menus.
Makes the XML somewhat easier to read.
2004-05-02 Sven Neumann <sven@gimp.org>
* menus/Makefile.am
* menus/dialogs-menuitems.xml: new file that holds menuitems that
appear in several places.
* menus/dockable-menu.xml.in: new file used to generate
dockable-menu.xml.
* menus/toolbox-menu.xml.in: new file used to generate
toolbox-menu.xml.
* menus/image-menu.xml.in: include dialogs-menuitems.xml.
* menus/menus.xsl: allow inclusion of menuitems using XInclude.
2004-05-02 Michael Natterer <mitch@gimp.org>
* app/actions/Makefile.am
* app/actions/file-dialog-actions.[ch]: new files containing
factored out code to set up the <Load> and <Save> actions.
Use GimpPlugInActions instead of just GtkActions.
* app/actions/file-dialog-commands.[ch]: new files containing
file_dialog_type_cmd_callback() which is a
GimpPlugInAction::selected() callback now.
* app/actions/file-commands.[ch]: removed the callback here.
* app/actions/file-open-actions.c
* app/actions/file-save-actions.c: removed code duplication and
use file_dialog_actions_setup() instead.
2004-05-02 Michael Natterer <mitch@gimp.org>
* app/actions/*-actions.c: added help IDs to all actions
representing the toplevel popups and menus (as fallbacks for the
still-to-be-written help system intrgration of GimpUIManager).
* app/display/gimpdisplayshell.c (gimp_display_shell_new): removed
call to gtk_ui_manager_ensure_update() because that's done by
gimp_ui_manager_ui_get() now.
* app/widgets/gimpmenufactory.[ch]: removed API to register and
create item factories.
* app/gui/menus.c: changed accordingly.
* app/gui/dialogs.c
* app/actions/plug-in-commands.c
* app/gui/file-dialog-utils.c
* app/gui/file-save-dialog.c
* app/widgets/gimpdataeditor.c
* app/widgets/gimpdockable.c
* app/widgets/gimpdockbook.[ch]
* app/widgets/gimpimagedock.c
* app/widgets/gimpitemtreeview.c: removed leftover item factory
cruft.
* app/widgets/widgets-types.h: removed item factory typedefs...
* app/widgets/gimpitemfactory.h: ...and added them here.
* app/widgets/gimpactiongroup.[ch]: added new function
gimp_action_group_add_plug_in_actions().
* app/actions/plug-in-actions.c: use it here instead of adding
the actions manually.
* app/widgets/gimptoolbox.c: ported the code which dynamically
updates the tool button tooltips on accelerator changes to
GtkAction. Disabled the whole stuff because GTK+ lacks
gtk_action_get_accel_closure().
2004-05-02 Sven Neumann <sven@gimp.org>
* menus/Makefile.am: added a rule to generate gtkuimanager XML
files using an XSL transformation.
* menus/menus.xsl: a simple XSLT to generate a menubar and a popup
menu with identical content.
* menus/image-menu.xml: removed this file from CVS ...
* menus/image-menu.xml.in: ... and added this instead.
* HACKING: xsltproc is now needed to build from CVS.
2004-05-01 Sven Neumann <sven@gimp.org>
* configure.in: check for xmllint and xsltproc but don't require
these tools.
* menus/Makefile.am
* tips/Makefile.am: simplified "validate" targets.
2004-04-30 Pedro Gimeno <pggimeno@wanadoo.es>
* app/tools/gimprectselecttool.c: Cleanups.
(gimp_rect_select_tool_coords_to_integer): Undo my bogus fix for
bug #138103, which led to bug #140649.
* app/pdb/procedural_db.c (procedural_db_init_procs): Add missing
compat procs: gimp_channel_ops_duplicate, gimp_channel_ops_offset.
2004-04-30 Sven Neumann <sven@gimp.org>
* app/gui/tool-options-menu.c: added casts to please the compiler.
2004-04-30 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpuimanager.[ch]: added signal "update" which
is G_SIGNAL_RUN_LAST, so handlers can hook in before and after
the default implementation. Update the action groups
in the default implementations.
(gimp_ui_manager_ui_get): make sure we always return a widget
by calling gtk_ui_manager_ensure_update().
* app/widgets/gimpdockable.c (gimp_dockable_show_menu): make
sure the dockable menu is loaded before trying to access its
widgets/actions.
Resurrected the dynamic tool options menus:
* app/actions/tool-options-actions.c: dynamically destroy/create
actions for the tool options' presets.
* app/actions/tool-options-commands.[ch]: all callbacks are
GimpEnumAction::selected() callbacks now.
* app/gui/tool-options-menu.[ch]: connect and connect_after to
GimpUIManager::update(). Remove the old preset menu items
in the former callback, create the new ones in the latter.
Removed the last item factory entries.
* app/gui/menus.c
* app/widgets/gimptooloptionseditor.c: changed accordingly.
2004-04-29 Simon Budig <simon@gimp.org>
* app/main.c: when glibc is used, call mallopt, so that memory
chunks >= 4k (= 64*64 pixels, 1bpp - the smallest full tile)
get allocated via mmap. This ensures that after closing an image
the memory allocated for image data gets returned to the system.
Thanks to Phil Blundell <pb@nexus.co.uk> for bringing mallopt
to my attention.
Please watch closely for performance problems.
2004-04-29 Michael Natterer <mitch@gimp.org>
* app/actions/Makefile.am
* app/actions/file-open-actions.[ch]
* app/actions/file-save-actions.[ch]: actions for the <Load> and
<Save> menus...
* menus/Makefile.am
* menus/file-open-menu.xml
* menus/file-save-menu.xml: ...and the menus.
* app/gui/file-open-menu.[ch]
* app/gui/file-save-menu.[ch]: ported to UI Manager.
* app/widgets/gimpfiledialog.[ch]: ditto.
* app/actions/actions.c
* app/gui/menus.c
* app/gui/file-open-dialog.c
* app/gui/file-save-dialog.c: changed accordingly.
* app/widgets/gimpuimanager.c: removed debugging code which
automatically loaded all registered menus. They are now loaded on
demand only.
2004-04-29 Michael Natterer <mitch@gimp.org>
* libgimpbase/gimputils.[ch] (gimp_escape_uline): new function
which does the opposite of gimp_strip_uline().
* app/actions/file-actions.c (file_actions_last_opened_update):
escape ulines in filenames so they don't end up as mnemonics.
Spotted by Pedro Gimeno.
2004-04-29 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/plug-ins/py-slice.py: Quick fix to make uppercase
tags work properly.
2004-04-29 Michael Natterer <mitch@gimp.org>
* app/tools/gimp*tool.c (gimp_*_tool_register): stripped the menu
paths from the "menu_path". Will be renamed to "action_name" or
something soon...
* plug-ins/dbbrowser/dbbrowser.c
* plug-ins/common/plugindetails.c
* plug-ins/common/uniteditor.c: register under the new
"Extensions" placeholder.
2004-04-29 Michael Natterer <mitch@gimp.org>
Switch from GtkItemFactory to GtkUIManager. The migration is
almost complete, still stuff missing/incomplete, definitely added
a bunch of new bugs...
* app/actions/*-commands.[ch]: converted all callback from
GtkItemFactory callbacks to GtkAction callbacks.
* app/actions/debug-actions.c
* app/actions/gradient-editor-actions.c
* app/actions/help-actions.c
* app/actions/plug-in-actions.c
* app/actions/qmask-actions.c
* app/actions/tool-options-actions.c: various fixes.
* app/display/gimpdisplay.[ch]
* app/display/gimpdisplayshell-appearance.[ch]
* app/display/gimpdisplayshell-callbacks.c
* app/display/gimpdisplayshell.[ch]: move everything from
GtkItemFactory to GtkUIManager.
* app/gui/dialogs.[ch]: added new function dialogs_get_toolbox().
Needed because the action callbacks don't have a widget parameter
and sometimes we need a parent window for showing dialogs.
* app/gui/Makefile.am
* app/gui/brushes-menu.[ch]
* app/gui/buffers-menu.[ch]
* app/gui/channels-menu.[ch]
* app/gui/colormap-editor-menu.[ch]
* app/gui/dialogs-menu.[ch]
* app/gui/documents-menu.[ch]
* app/gui/error-console-menu.[ch]
* app/gui/fonts-menu.[ch]
* app/gui/gradient-editor-menu.[ch]
* app/gui/gradients-menu.[ch]
* app/gui/images-menu.[ch]
* app/gui/layers-menu.[ch]
* app/gui/palette-editor-menu.[ch]
* app/gui/palettes-menu.[ch]
* app/gui/patterns-menu.[ch]
* app/gui/qmask-menu.[ch]
* app/gui/templates-menu.[ch]
* app/gui/vectors-menu.[ch]: removed these files.
* app/gui/gui.c: create a global UI manager for the image popup
menu and the toolbox menubar.
* app/gui/menus.[ch]: removed all GtkItemFactory code.
* app/gui/image-menu.[ch]
* app/gui/toolbox-menu.[ch]: removed everything except the trivial
setup_funcs.
* app/gui/file-open-menu.c
* app/gui/file-save-menu.c
* app/gui/tool-options-menu.c: don't use the macros from menus.h
any more, they are gone.
* app/gui/gui-vtable.c
* app/gui/plug-in-menus.[ch]: create/destroy the dynamic plug-in
menu entries.
* app/tools/gimpimagemaptool.c: s/gimp_item_factory_update/
gimp_ui_manager_update/g
* app/widgets/gimpuimanager.[ch]: added API to get an action
group by name.
* app/widgets/gimpmenufactory.c: don't choke on the item_factory
entries being NULL.
* app/widgets/gimpactiongroup.c: make sure booleans set using
g_object_set() only have TRUE or FALSE values.
* app/widgets/gimpcolormapeditor.c
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainereditor.[ch]
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimpdockable.[ch]
* app/widgets/gimpdocked.[ch]
* app/widgets/gimpeditor.[ch]
* app/widgets/gimperrorconsole.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimppaletteeditor.c
* app/widgets/gimptoolbox.c
* app/widgets/gimptooloptionseditor.c: removed all GtkItemFactory
code and enable the #if 0'ed UI manager stuff.
* menus/gradient-editor-menu.xml: fixed typos.
* menus/image-menu.xml: duplicate everything so we have both
an image menubar and an image popup menu. Badly cries for an
XSL processor.
* menus/toolbox-menu.xml: added an "Extensions" placeholder.
2004-04-27 Michael Natterer <mitch@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimppluginaction.[ch]: new GtkAction subclass which
remembers the PlugInProcDef.
* app/widgets/gimpactiongroup.[ch]: added "gpointer user_data" to
the GimpActionGroup struct and to gimp_action_group_new(). Removed
the user_data parameter from gimp_action_group_add_*_actions().
* app/widgets/gimpactionfactory.[ch]: changed accordingly.
* app/actions/*-actions.[ch]: removed user_data from all setup_funcs.
* app/actions/plug-in-actions.c: use a GimpPlugInAction and
finally use the right user_data for the callback so plug-in
callbacks have a proper context.
* app/gui/plug-in-menus.[ch]: renamed plug_in_menus_create2() to
plug_in_menus_setup().
* app/gui/image-menu.c
* app/gui/toolbox-menu.c: changed accordingly.
2004-04-27 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpactiongroup.[ch]: removed "translation-domain"
property and simply use gettext(). Plug-In domains are handled
by plug-in-actions.c
The following change finally starts breaking the old menu system
while the new one is not fully in place yet. Have fun:
* menus/image-menu.xml: added several <placeholder>s for plug-ins
to register their menu entries in the middle of already existing
menus.
* app/gui/menus.c
* plug-ins/common/mail.c
* plug-ins/print/print.c
* plug-ins/script-fu/scripts/copy-visible.scm: use the new
placeholders to register menu entries.
2004-04-27 Michael Natterer <mitch@gimp.org>
Correctly translated & sorted plug-in actions & menu entries:
* app/widgets/gimpuimanager.[ch]: added a "gchar *name" property
and a hash table which keeps all created UI managers (similar to
GimpActionGroup's hash table). Added function
gimp_ui_managers_from_name() which returns a list of all managers
with the given name.
* app/widgets/gimpmenufactory.c: register a name per UI manager
and pass the name to gimp_ui_manager_new().
* app/actions/plug-in-actions.c: added code which correctly
translates the created plug-in actions and also creates translated
menu actions for the plug-in's menu_path elements.
* app/gui/plug-in-menus.[ch]: sort the plug-ins' menu entries
using a GTree. For each entry, recursivlely create submenus
from the dynamic menu actions created above before creating
the plug-in's menu entry itself.
* app/gui/image-menu.c (image_menu_setup2)
* app/gui/toolbox-menu.c (toolbox_menu_setup2): call
plug_in_menus_create2().
* app/gui/gui-vtable.c (gui_menus_create_entry)
(gui_menus_delete_entry): added some uglyness which maps old <Prefix>
menu identifiers to new-style UI manager plus ui_path tuples and
call plug_in_menus_add,remove_proc() accordingly.
* menus/image-menu.xml
* menus/toolbox-menu.xml: added name="Foo" attributes to all menus
so plug-in entries find their place.
2004-04-27 Michael Natterer <mitch@gimp.org>
* app/gui/gui.c (gui_restore_callback): call actions_init()
(gui_exit_after_callback): call actions_exit().
* app/gui/menus.c (menus_init)
(menu_exit): don't call them here.
2004-04-26 Michael Natterer <mitch@gimp.org>
* app/widgets/widgets-types.h: added GimpUIManagerSetupFunc typedef.
* app/widgets/gimpuimanager.[ch]: added the setup_func to the
GimpUIManagerUIEntry struct and to gimp_ui_manager_ui_register().
Call the setup_func after creating the UI. Replaced the term
"identifier" by "ui_path".
* app/widgets/gimpmenufactory.c: ditto.
* app/gui/menus.c (menus_init): register the new setup_funcs below.
* app/gui/menus.[ch] (menus_open_recent_add)
* app/gui/image-menu.[ch] (image_menu_setup2)
* app/gui/toolbox-menu.[ch] (toolbox_menu_setup2): new setup_funcs
which add the "Open Recent" menu items.
* app/actions/file-actions.c: removed "file-open-recent-empty"
action because it's not needed.
* menus/image-menu.xml
* menus/toolbox-menu.xml: removed "file-open-recent-empty" menu
items and added <placeholder>s for the "Open Recent" menu items.
2004-04-26 Michael Natterer <mitch@gimp.org>
* app/core/gimp.[ch]: removed "locale_domain" and "help_domain"
parameters from GimpMenusCreateFunc.
* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add)
* app/actions/plug-in-actions.[ch] (plug_in_actions_add_proc_def):
changed accordingly.
* app/widgets/gimpactiongroup.[ch]: remember all created action
groups is a hash table in GimpActionGroupClass. Added
gimp_action_groups_from_name() which returns a GList of all groups
with the given name.
* app/actions/plug-in-actions.[ch] (plug_in_actions_setup):
removed the tree sorting code. Actions don't need to be ordered
alphabetically.
(plug_in_actions_update): copied & ported plug_in_menus_update().
* app/gui/gui-vtable.c (gui_menus_create,delete_entry):
dynamically add/remove plug-in actions in all "plug-in" action
groups.
2004-04-25 Michael Natterer <mitch@gimp.org>
* app/core/gimp.[ch]: changed GimpMenusDeleteFunc to take
a PlugInProcDef* instead of a const gchar*.
* app/plug-in/plug-ins.c
* app/gui/gui-vtable.c
* app/gui/plug-in-menus.[ch]: changed accordingly.
2004-04-25 Sven Neumann <sven@gimp.org>
* plug-ins/common/AlienMap2.c: some UI improvements based on a
patch by William Skaggs (bug #140079).
2004-04-22 Sven Neumann <sven@gimp.org>
* app/gui/dialogs-constructors.c
* app/gui/preferences-dialog.c: silent the compiler.
* plug-ins/winicon/icodialog.c: simplified by using a
GimpIntComboBox.
2004-04-22 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpuimanager.[ch]: remember and ref the created
widgets. Added gimp_ui_manager_ui_popup() which pops up a GtkMenu
with a custom GimpMenuPositionFunc and a GtkDestroyNotify which is
called on popdown.
* app/widgets/gimpmenufactory.c (gimp_menu_factory_finalize):
don't forget to free the list of managed UIs.
* app/widgets/gimpdockable.[ch]
* app/widgets/gimpdockbook.[ch]
* app/widgets/gimpdocked.[ch]
* app/widgets/gimpeditor.[ch]: added GimpUIManager stuff parallel
to the to-be-removed GtkItemFactory stuff.
* app/widgets/gimpcolormapeditor.c
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainereditor.c
* app/widgets/gimpcontainergridview.c
* app/widgets/gimpcontainertreeview.c
* app/widgets/gimperrorconsole.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpitemtreeview.c
* app/widgets/gimppaletteeditor.c
* app/widgets/gimptooloptionseditor.c: changed accordingly and added
#if 0'ed code which actually uses all the UI managers.
* app/display/gimpdisplay.c
* app/display/gimpdisplayshell.c
* app/gui/gui-vtable.c: disabled some gimp_ui_manager_update()
calls because they were invoking toggle and radio callbacks
which still have the wrong signature.
2004-04-22 Sven Neumann <sven@gimp.org>
* plug-ins/gflare/gflare.c: ported the last plug-in from
GtkOptionMenu to GimpIntComboBox.
* plug-ins/common/newsprint.c: changed a comment that was still
talking about option menus.
2004-04-22 Michael Natterer <mitch@gimp.org>
* app/gui/menus.c (menus_init): fixed some typos in the UI Manager
registration code.
2004-04-22 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpactiongroup.[ch]: implemented
gimp_action_group_set_action_color() and
gimp_action_group_set_action_viewable().
* app/actions/*-actions.c: added stock IDs to all actions which
represent toplevel popup menus. Fixed typos.
* menus/brushes-menu.xml
* menus/colormap-editor-menu.xml
* menus/dockable-menu.xml
* menus/gradients-menu.xml
* menus/patterns-menu.xml
* menus/toolbox-menu.xml: fixed typos.
2004-04-22 Sven Neumann <sven@gimp.org>
* plug-ins/rcm/rcm_callback.[ch]
* plug-ins/rcm/rcm_dialog.c: ported from GtkOptionMenu to
GimpIntComboBox.
2004-04-22 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpintstore.[ch]: automatically add an "(Empty)"
item if the store is empty and remove it as soon as other items
are being added.
* libgimp/gimpdrawablecombobox.c
* libgimp/gimpimagecombobox.c: removed handling of the empty list;
the store does this for us now.
2004-04-22 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpintcombobox.c (gimp_int_combo_box_new):
removed the check for first_label != NULL. Passing a NULL label
makes a perfect empty combo_box.
* plug-ins/common/newsprint.c
* plug-ins/common/spheredesigner.c: ported from GtkOptioMenu to
GimpIntComboBox.
2004-04-22 Sven Neumann <sven@gimp.org>
* plug-ins/flame/flame.c
* plug-ins/gimpressionist/brush.c: ported the last two users of
gimpmenu.h to GimpDrawableComboBox.
* libgimp/gimpmenu.[ch]: declared the functions found here as
deprecated.
* plug-ins/common/plugindetails.c
* plug-ins/ifscompose/ifscompose.c: silent the compiler.
2004-04-21 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablecombobox.c
* libgimp/gimpimagecombobox.c
* libgimp/gimpmenu.c: changed the label for the empty menu from
"None" to "Empty" since that's what GTK+ uses.
* libgimpwidgets/gimpintcombobox.[ch]: added convenience function
gimp_int_combo_box_connect().
* plug-ins/common/bumpmap.c
* plug-ins/common/compose.c
* plug-ins/common/depthmerge.c
* plug-ins/common/displace.c
* plug-ins/common/lic.c
* plug-ins/common/warp.c: ported to GimpDrawableComboBox.
* plug-ins/Lighting/lighting_ui.c
* plug-ins/MapObject/mapobject_ui.c
* plug-ins/common/sample_colorize.c: use
gimp_int_combo_box_connect(). This restores the correct behaviour
of setting the drawable_ID to the first drawable from the list if
it's invalid.
2004-04-21 Michael Natterer <mitch@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpuimanager.[ch]: new GtkUIManager subclass. Adds
API to update all action groups and knows which UIs it can create
from which XML files.
* app/widgets/gimpmenufactory.[ch]: register the XML file
basenames along with path of their toplevel menus. Create
GimpUIManagers instead of GtkUIManagers and register the
XML files and menu paths with them.
* app/gui/menus.c: register all XML files and their toplevel
menu paths.
* app/widgets/gimpeditor.[ch]: also create a GimpUIManager when
creating the GtkItemFactory. Added "const gchar *ui_identifier"
parameter to gimp_editor_create_menu().
* app/widgets/gimpcontainereditor.[ch]
* app/widgets/gimpdataeditor.[ch]
* app/widgets/gimpdatafactoryview.[ch]
* app/widgets/gimpitemtreeview.[ch]: added "ui_identifier"
parameters to all constructors.
* app/widgets/gimpbrusheditor.c
* app/widgets/gimpbrushfactoryview.c
* app/widgets/gimpbufferview.c
* app/widgets/gimpcolormapeditor.c
* app/widgets/gimpcomponenteditor.c
* app/widgets/gimpcontainerpopup.c
* app/widgets/gimpdocumentview.c
* app/widgets/gimperrorconsole.c
* app/widgets/gimpfontview.c
* app/widgets/gimpgradienteditor.c
* app/widgets/gimpimageview.c
* app/widgets/gimppaletteeditor.c
* app/widgets/gimppatternfactoryview.c
* app/widgets/gimptemplateview.c
* app/widgets/gimptooloptionseditor.c
* app/gui/dialogs-constructors.c
* app/gui/gradient-select.c
* app/gui/palette-select.c
* app/gui/pattern-select.c: pass UI identifiers to the changed
functions above.
* app/display/gimpdisplayshell.[ch]: added a GimpUIManager for
the menubar (menubar creating code still commented out).
* app/display/gimpdisplay.c
* app/gui/gui-vtable.c: update the ui manager.
2004-04-21 Michael Natterer <mitch@gimp.org>
* app/actions/actions.c: forgot to register the "patterns" actions.
* app/actions/*-actions.c: added actions representing the toplevel
menus (popups and menubars). Fixed some typos.
* menus/*-menu.xml: added action="foo" attributes to all toplevel
menus. Fixed typos here too.
* menus/gtkuimanager.dtd: fixed possible attributes.
2004-04-21 Sven Neumann <sven@gimp.org>
* libgimp/gimpmenu.c (gimp_menu_add_none): use the same label as
in the new combo_box widgets.
* libgimpwidgets/gimpintcombobox.[ch]
* libgimpwidgets/gimpintstore.[ch]: use LibGIMP copyright headers.
2004-04-21 Sven Neumann <sven@gimp.org>
* libgimp/gimpdrawablecombobox.c
* libgimp/gimpimagecombobox.c
* libgimp/gimppixbuf.c
* libgimpwidgets/gimpintcombobox.c
* libgimpwidgets/gimpintstore.c: API documentation.
2004-04-21 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpintcombobox.[ch]: added new functions
gimp_int_combo_box_[prepend|append].
* plug-ins/common/sample_colorize.c: ported to GimpDrawableComboBox.
2004-04-21 Michael Natterer <mitch@gimp.org>
* app/actions/qmask-actions.c
* app/actions/qmask-commands.c: prepared qmask_actions_update()
and the qmask callbacks to be merged into the image ui manager.
* app/actions/dialogs-actions.c
* app/actions/edit-actions.c
* app/actions/file-actions.c
* app/actions/image-actions.c
* app/actions/layers-actions.c
* app/actions/plug-in-actions.c
* app/actions/tools-actions.c
* app/actions/view-actions.c: fixed lots of typos and buglets
spotted in my first test run.
* app/gui/menus.c: register the needed action groups with the
<Image> menu.
* app/tools/gimp-tools.c
* app/tools/gimpdodgeburntool.[ch]
* app/tools/gimppaintoptions-gui.c: s/dodgeburn/dodge_burn/g.
* app/widgets/gimpactionfactory.c
* app/widgets/gimpmenufactory.[ch]: s/G_GNUC_FUNCTION/G_STRFUNC/g,
updated copyright header.
* menus/image-menu.xml: fixed typos and added the "Filters"
submenus.
2004-04-21 Michael Natterer <mitch@gimp.org>
More unused action stuff:
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpactionfactory.[ch]: added a simple factory which
produces GimpActionGroups.
* app/widgets/gimpactiongroup.[ch]: added an "update_func" member
to the GimpActionGroup struct. Added it as parameter to
gimp_action_group_new(). Added function gimp_action_group_update().
* app/widgets/gimpmenufactory.[ch]: added an "action_factory"
member and constructor parameter. Added code to create
GtkUIManagers from registered action group identifiers.
* app/actions/Makefile.am
* app/actions/actions.[ch]: new files: create a
"global_action_factory" and register all action groups with it.
* app/actions/edit-actions.c: s/edit_action_update/edit_actions_update/
* app/actions/plug-in-actions.[ch]: added API to add/remove
plug-in procedure actions dynamically (unfinished).
* app/gui/menus.c (menus_init): call actions_init().
(menus_exit): call actions_exit().
2004-04-21 Sven Neumann <sven@gimp.org>
* plug-ins/Lighting/lighting_ui.c
* plug-ins/MapObject/mapobject_ui.c: ported to the new API.
2004-04-21 Sven Neumann <sven@gimp.org>
* libgimp/Makefile.am
* libgimp/gimpui.h
* libgimp/gimppixbuf.[ch]: new file that holds pixbuf accessors
to gimp data (drawable and image thumbnails for now).
* libgimp/gimpdrawablecombobox.[ch]
* libgimp/gimpimagecombobox.[ch]: new files with GimpIntComboBox
constructors for image, drawable, channel and layer menus.
* plug-ins/script-fu/script-fu-scripts.c: use the new functions
instead of the gimpmenu API that is about to be deprecated.
2004-04-20 Sven Neumann <sven@gimp.org>
* tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail): removed
color cast. Merged from stable branch.
* app/pdb/fileops_cmds.c: regenerated.
2004-04-20 Sven Neumann <sven@gimp.org>
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpwidgets.h
* libgimpwidgets/gimpwidgetstypes.h
* libgimpwidgets/gimpintstore.[ch]: added a GimpIntStore, derived
from GtkListStore, to be used by GimpIntComboBox and also by the
image and drawable menus.
* libgimpwidgets/gimpintcombobox.c: use the new GimpIntStore.
* app/widgets/gimpenumstore.[ch]: derive from GimpIntStore,
removed API that is provided by the parent class.
* app/widgets/gimpenumcombobox.[ch]: derive from GimpIntComboBox,
removed API that is provided by the parent class.
* app/gui/resize-dialog.c
* app/tools/gimpcurvestool.c
* app/tools/gimplevelstool.c
* app/widgets/gimpcolorframe.c
* app/widgets/gimphistogrameditor.c
* app/widgets/gimppropwidgets.c
* app/widgets/gimpstrokeeditor.c: changed accordingly.
2004-04-20 Sven Neumann <sven@gimp.org>
* app/widgets/gimpenumstore.[ch]
* app/widgets/gimpenumcombobox.c: let the pixbuf renderer take care
of rendering the pixbuf from the stock_id.
2004-04-20 Sven Neumann <sven@gimp.org>
* libgimpwidgets/gimpmemsizeentry.c
* modules/cdisplay_colorblind.c
* modules/cdisplay_proof.c: ported to GimpIntComboBox.
* libgimpwidgets/gimpwidgets.[ch]: declared the gimp option_menu
API as deprecated and removed the code here.
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpoldwidgets.[ch]: new files with deprecated
code, guarded with #ifndef GIMP_DISABLE_DEPRECATED ... #endif.
* libgimpwidgets/gimpintcombobox.h: added G_BEGIN_DECLS, G_END_DECLS.
* configure.in (CPP_FLAGS): added -DGIMP_DISABLE_DEPRECATED.
* app/widgets/gimpwidgets-constructors.c: added a #warning and
#undef GIMP_DISABLE_DEPRECATED. The paint mode menu is the last
remaining user of gimp_int_option_menu_new().
2004-04-20 Michael Natterer <mitch@gimp.org>
* app/gui/convert-dialog.[ch]: renamed convert_to_indexed()
to convert_dialog_new() and return the dialog. Removed
convert_to_rgb() and convert_to_grayscale().
* app/gui/offset-dialog.[ch]: renamed offset_dialog_create()
to offset_dialog_new() and return the dialog.
* app/Makefile.am
* app/actions/drawable-commands.c
* app/actions/image-commands.c: changed accordingly.
2004-04-20 Michael Natterer <mitch@gimp.org>
* app/gui/*-commands.[ch]: removed...
* app/actions/*-commands.[ch]: ...and added here.
* app/gui/Makefile.am
* app/gui/*-menu.c
* app/gui/dialogs-constructors.c
* app/gui/gui.c
* app/gui/menus.c
* app/actions/Makefile.am
* app/actions/*-actions.c: changed accordingly.
* app/actions/plug-in-actions.[ch]
* app/actions/tools-actions.[ch]: new files.
* app/Makefile.am: had to add more -u evilness because gui/
and actions/ have cyclic dependencies.
* menus/image-menu.xml: added some more items.
2004-04-20 Sven Neumann <sven@gimp.org>
* app/widgets/gimpwidgets-constructors.[ch]: added new function
gimp_paint_mode_menu_set_history().
* app/gui/brush-select.c
* app/widgets/gimplayertreeview.c
* app/widgets/gimppropwidgets.c: use the new function instead of
the deprecated gimp_int_option_menu API.
2004-04-20 Sven Neumann <sven@gimp.org>
* plug-ins/common/align_layers.c
* plug-ins/common/borderaverage.c
* plug-ins/common/channel_mixer.c
* plug-ins/common/gif.c
* plug-ins/common/mng.c
* plug-ins/flame/flame.c
* plug-ins/gfig/gfig.c: ported remaining plug-ins to GimpIntComboBox.
2004-04-20 Sven Neumann <sven@gimp.org>
* plug-ins/common/iwarp.c (iwarp_get_pixel): check tile != NULL
before unrefing it. Fixes bug #140554; merged from stable branch.
2004-04-20 Sven Neumann <sven@gimp.org>
* app/widgets/gimpenumcombobox.c: added more sanity checks.
* libgimpwidgets/gimpintcombobox.[ch]: added another GimpIntComboBox
constructor: gimp_int_combo_box_new_array().
* plug-ins/Lighting/lighting_ui.c
* plug-ins/MapObject/mapobject_ui.c
* plug-ins/common/CML_explorer.c: ported to GimpIntComboBox.
2004-04-20 Sven Neumann <sven@gimp.org>
* libgimpwidgets/Makefile.am
* libgimpwidgets/gimpwidgets.h
* libgimpwidgets/gimpwidgetstypes.h
* libgimpwidgets/gimpintcombobox.[ch]: added new widget
GimpIntComboBox, a GtkComboBox with a simple list store to hold a
label and an associated integer value. This is going to replace
gimp_int_option_menu.
* plug-ins/common/jpeg.c
* plug-ins/print/gimp_main_window.c: ported these two plug-ins to
the newly added widget.
2004-04-20 Sven Neumann <sven@gimp.org>
* plug-ins/gfig/gfig.c: removed unused return locations for menu
item pointers.
2004-04-19 Sven Neumann <sven@gimp.org>
* configure.in: set gimp_plugin_version, gimp_sysconf_version and
gimp_data_version to 2.1 so that the development version is
clearly separated from stable gimp 2.0.
2004-04-19 Michael Natterer <mitch@gimp.org>
* menus/Makefile.am
* menus/image-menu.xml
* menus/tool-options-menu.xml: more menus.
2004-04-19 Sven Neumann <sven@gimp.org>
* app/widgets/gimpactiongroup.c
* app/widgets/gimpenumcombobox.c
* app/widgets/gimpenumstore.c: fixed inline docs.
* app/widgets/gimpenumaction.c: fixed property declaration.
2004-04-19 Michael Natterer <mitch@gimp.org>
* app/gui/colormap-editor-commands.[ch]
* app/gui/debug-commands.[ch]
* app/gui/dockable-commands.[ch]
* app/gui/error-console-commands.[ch]
* app/gui/file-commands.[ch]
* app/gui/gradient-editor-commands.[ch]
* app/gui/help-commands.[ch]
* app/gui/qmask-commands.[ch]
* app/gui/tool-options-commands.[ch]: removed "guint action"
parameter from all callbacks which don't need it.
2004-04-19 Sven Neumann <sven@gimp.org>
* menus/Makefile.am
* menus/gtkuimanager.dtd: added a DTD (basically copied from the
GTK+ API docs). Added a "validate" rule that allows to easily
validate the XML files.
* menus/*.xml: added a DOCTYPE declaration that refers to the
newly added DTD.
* app/widgets/gimpenumstore.[ch]:
* app/widgets/gimpenumcombobox.c: documented the new API.
2004-04-19 Michael Natterer <mitch@gimp.org>
* app/actions/Makefile.am
* app/actions/actions-types.h: oops, forgot to commit this one.
2004-04-19 Michael Natterer <mitch@gimp.org>
* menus/Makefile.am
* menus/toolbox-menu.xml: added the toolbox menu.
2004-04-19 Michael Natterer <mitch@gimp.org>
More GtkAction stuff (still unused):
* configure.in: added new directories menus/ and app/actions/
* Makefile.am: build menus/
* menus/.cvsignore
* menus/Makefile.am
* menus/*-menu.xml: new files: XML menu descriptions for each menu
which is now defined in gui/*-menu.c.
* app/widgets/widgets-types.h: some typedefs for GimpActionGroup.
* app/widgets/gimpactiongroup.[ch]: added a "Gimp" construct-only
property. Added APIs to set actions visible/sensitive/active
and an unimplemented stub for setting the action's color.
* app/Makefile.am: build actions/ and link libappactions.a
* app/actions/.cvsignore
* app/actions/Makefile.am
* app/actions/*-actions.[ch]: new files: GtkActions for each
*-commands.c file in gui/. Ported all "update" functions from the
*-menu.c files.
(everything completely unused, untested and partly #if 0'ed)
* app/core/gimpimage.[ch]: for reasons of (action-) symmetry, added
API to raise/lower channels/vectors to top/bottom.
* app/gui/channels-commands.[ch]
* app/gui/vectors-commands.[ch]: added callbacks for the new
to top/bottom functions.
* app/gui/Makefile.am
* app/gui/dockable-commands.[ch]: new files split out of
dialogs-commands.[ch].
* app/gui/dialogs-commands.[ch]
* app/gui/dialogs-menu.c: changed accordingly.
* app/gui/edit-commands.[ch]: added edit_paste_into_cmd_callback()
and remove usage of "guint action".
* app/gui/image-menu.c: changed accordingly.
* app/gui/palette-editor-commands.[ch]: split
+palette_editor_new_color_cmd_callback() into separate callbacks
for adding from FG and BG.
* app/gui/palette-editor-menu.c: changed accordingly.
2004-04-19 Henrik Brix Andersen <brix@gimp.org>
* plug-ins/script-fu/scripts/gimp-headers.scm
* plug-ins/script-fu/scripts/gimp-labels.scm: applied a patch from
William Skaggs which changes the sub menu title for the gimp web
theme to classic.gimp.org. Fixes bug #137036.
2004-04-19 Sven Neumann <sven@gimp.org>
* app/widgets/gimpdrawabletreeview.c: removed unused includes.
2004-04-19 Sven Neumann <sven@gimp.org>
* app/widgets/gimppropwidgets.[ch]
* app/gui/preferences-dialog.c: replaced
gimp_prop_boolean_option_menu_new() with
gimp_prop_boolean_combo_box_new().
2004-04-19 Sven Neumann <sven@gimp.org>
* app/widgets/gimpenumstore.[ch]: avoid unnecessary casts.
* app/widgets/gimpenumcombobox.[ch]: added an API that inserts a
GtkTreeModelFilter to make items invisible. This is a kludge to
workaround bug #135875.
* app/tools/gimpcurvestool.c
* app/tools/gimplevelstool.c
* app/widgets/gimphistogrameditor.c: use the new function to hide
channels that are not available.
2004-04-18 Henrik Brix Andersen <brix@gimp.org>
* app/widgets/gimptemplateeditor.c
(gimp_template_editor_constructor): use g_signal_connect_object()
instead of g_signal_connect(). Fixes bug #140315.
2004-04-18 Pedro Gimeno <pggimeno@wanadoo.es>
* plug-ins/common/gauss_rle.c (gauss_rle): Oops, fixed my fix.
2004-04-18 Pedro Gimeno <pggimeno@wanadoo.es>
* plug-ins/common/gauss_iir.c: Change tabs to spaces all over the
file, in preparation for other changes. Minor cleanup.
* plug-ins/common/gauss_rle.c (gauss_rle): Plug a leak with the
returned value from make_curve().
* plug-ins/common/tga.c (load_image): Fix a condition which was
preventing GRAYA images from loading.
2004-04-18 Sven Neumann <sven@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpenummenu.[ch]: removed GimpEnumMenu.
* app/widgets/gimpenumwidgets.[ch]: moved widget constructors that
don't use GimpEnumMenu from gimpenummenu.[ch] to these new files.
* app/widgets/gimpenumcombobox.[ch]: added a GtkComboBox widget
using GimpEnumStore; replaces GimpEnumMenu.
* app/widgets/gimpenumstore.[ch]: added new function
gimp_enum_store_lookup_by_value().
* app/widgets/gimppropwidgets.[ch]: replaced
gimp_prop_enum_option_menu_new() with gimp_prop_enum_combo_box_new().
* app/gui/brush-select.[ch]
* app/gui/convert-dialog.c
* app/gui/layers-commands.c
* app/gui/preferences-dialog.c
* app/gui/resize-dialog.c
* app/tools/gimpblendoptions.c
* app/tools/gimpcolorbalancetool.c
* app/tools/gimpcroptool.c
* app/tools/gimpcurvestool.c
* app/tools/gimplevelstool.c
* app/tools/gimpmagnifytool.c
* app/tools/gimppaintoptions-gui.c
* app/tools/gimpselectionoptions.c
* app/tools/gimptransformoptions.c
* app/widgets/gimpcolorframe.c
* app/widgets/gimpeditor.c
* app/widgets/gimpgrideditor.c
* app/widgets/gimphistogrameditor.c
* app/widgets/gimpstrokeeditor.c
* app/widgets/gimptemplateeditor.c
* app/widgets/gimptexteditor.c: ported to GimpEnumComboBox.
2004-04-18 Sven Neumann <sven@gimp.org>
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpenumstore.[ch]: added (yet unused) GimpEnumStore,
a GtkListStore for enum values.
2004-04-18 Sven Neumann <sven@gimp.org>
* plug-ins/print/gimp_main_window.c: replaced wrong use of
gimp_option_menu with gimp_int_option_menu.
2004-04-18 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/script-fu-scripts.c: use a GtkComboBox for
SF-OPTION.
2004-04-18 Sven Neumann <sven@gimp.org>
* plug-ins/winicon/icodialog.c
* plug-ins/winicon/icosave.c: ported GtkOptionMenu to GtkComboBox.
2004-04-17 Sven Neumann <sven@gimp.org>
* app/widgets/gimpwidgets-constructors.[ch]:
s/GtkSignalFunc/GCallback/
2004-04-17 Henrik Brix Andersen <brix@gimp.org>
* app/tools/gimphuesaturationtool.c
(gimp_hue_saturation_tool_dialog): resolved conflicting
mnemonic. Fixes bug #139868.
2004-04-17 Henrik Brix Andersen <brix@gimp.org>
* plug-ins/common/jpeg.c (save_dialog): live preview doesn't
modify the undo history of the image anymore, label changed
accordingly. Fixes bug #140296.
2004-04-16 Pedro Gimeno <pggimeno@wanadoo.es>
* plug-ins/common/tile.c (tile): changed a call to
gimp_image_undo_enable to _undo_disable which was obviously the
intention of the author. Added a call to gimp_drawable_update to
get the previews refreshed.
2004-04-16 Sven Neumann <sven@gimp.org>
* app/tools/gimpcolorpickertool.c
* app/tools/gimpmeasuretool.c: don't use gtk_window_present() to
raise the tool dialog since it also moves the focus away from the
image window. Fixes the problem described in bug #139349.
2004-04-16 Sven Neumann <sven@gimp.org>
* app/tools/gimpcroptool.c: some code cleanup that I forgot to do
when applying the patch.
2004-04-16 Sven Neumann <sven@gimp.org>
* plug-ins/helpbrowser/dialog.c (browser_dialog_load): present the
help browser window.
2004-04-16 Sven Neumann <sven@gimp.org>
* plug-ins/helpbrowser/dialog.c: use a GtkComboBox instead of
GtkCombo and keep the history in a GtkListStore.
2004-04-16 Michael Natterer <mitch@gimp.org>
* app/core/gimpmarshal.list: new marshaller VOID:STRING
* app/widgets/Makefile.am
* app/widgets/widgets-types.h
* app/widgets/gimpactiongroup.[ch]
* app/widgets/gimpenumaction.[ch]
* app/widgets/gimpstringaction.[ch]: added some completely unused
GtkAction infrastructure.
2004-04-15 Manish Singh <yosh@gimp.org>
* tools/Makefile.am
* app/Makefile.am
* configure.in: app, tools, and user dir bumped to version 2.1 names.
* app/text/gimpfontlist.c: since we now depend on pango 1.4, we can
use pango_fc_font_description_from_pattern() instead of our
cut-n-paste function, gimp_font_list_font_desc_from_pattern().
2004-04-15 Tor Lillqvist <tml@iki.fi>
* app/plug-in/plug-in-message.c (plug_in_handle_proc_install)
* app/plug-in/plug-in-proc.h (struct _PlugInProcDef)
* app/plug-in/plug-in-rc.c (plug_in_rc_write)
* app/plug-in/plug-ins.c (plug_ins_init): Make PDB procedures
(including their menu entries) installed during a plug-ins init()
phase show up. Add a flag to PlugInProcDef that tells whether the
proc was installed during the init() phase. Such procs aren't
saved to the pluginrc. Move the code that initializes plug-ins
that need initialization earlier, before the procs are added to
the PDB and menus are built. Fixes bug #139969.
2004-04-16 Sven Neumann <sven@gimp.org>
* plug-ins/common/Makefile.am
* plug-ins/common/plugin-defs.pl
* plug-ins/common/AlienMap.c: removed the AlienMap plug-in since
AlienMap2 duplicates its functionality.
* plug-ins/common/AlienMap2.c: applied patch from William Skaggs
with a couple of user interface improvements (bug #140079).
2004-04-15 Tor Lillqvist <tml@iki.fi>
* libgimpthumb/Makefile.am: For Win32, install gimpthumb.def, like
the .def files of the other libgimp* libs.
* app/Makefile.am (INCLUDES): Add PANGOFT2_CFLAGS.
* gimp-zip.in: Put also libgimpthumb in the developer package.
2004-04-15 Sven Neumann <sven@gimp.org>
* plug-ins/winicon/icodialog.c: fixed gtk+ includes, added a
warning that deprecated widgets are being used.
2004-04-15 Sven Neumann <sven@gimp.org>
* configure.in
* plug-ins/Makefile.am
* plug-ins/winicon/Makefile.am
* plug-ins/winicon/icodialog.[ch]
* plug-ins/winicon/icoload.[ch]
* plug-ins/winicon/icosave.[ch]
* plug-ins/winicon/main.[ch]: added plug-in to load and save
Windows icon files. Plug-in written by Christian Kreibich, port to
GIMP-2.0 API by Gregor Riepl, massive code cleanup by me. Fixes
bug #139160.
2004-04-15 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpdnd.c (gimp_dnd_data_source_add)
(gimp_dnd_data_source_remove): use the new dynamic GtkTargetList
based API for changing the widget's drag source types.
* app/widgets/gimpdocumentview.c (gimp_document_view_new): simply
call gimp_dnd_file_source_add() instead of duplicating the whole
GtkTargetEntry array insanity just for adding one source type.
2004-04-15 Michael Natterer <mitch@gimp.org>
* plug-ins/FractalExplorer/Dialogs.c
* plug-ins/flame/flame.c
* plug-ins/gfig/gfig.c: first plug-ins ported to GtkFileChooser.
2004-04-15 Michael Natterer <mitch@gimp.org>
* app/display/gimpdisplayshell-callbacks.c
* app/display/gimpdisplayshell.c
* app/widgets/gimpcontainertreeview.c: removed runtime version
checks and workarounds for bugs which are fixed in GTK+ 2.4.
* app/widgets/gimpfiledialog.c
(gimp_file_dialog_selection_changed): added runtime check for GTK+
2.4.1 and work around GtkFileChooser's missing "update_preview"
functionality for multiple selections if the dependency is not
met.
* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
(gimp_menu_button_position): call gtk_menu_set_monitor() until
bug #139187 is fixed.
2004-04-15 Michael Natterer <mitch@gimp.org>
* app/widgets/gimpfiledialog.[ch]: derive it from GtkFileChooser
instead of GtkFileSelection.
* app/gui/file-dialog-utils.c
* app/gui/file-open-dialog.c
* app/gui/file-save-dialog.c
* app/widgets/gimpthumbbox.c: changed accordingly.
* app/gui/gradients-commands.c
* app/gui/vectors-commands.c
* app/tools/gimpimagemaptool.c
* app/widgets/gimperrorconsole.c
* app/widgets/gimptexteditor.c
* libgimpwidgets/gimpfileentry.c: use file choosers instead of
file selectors.
2004-04-15 Michael Natterer <mitch@gimp.org>
* configure.in: depend on glib 2.4.0, gtk+ 2.4.0, pangoft2 1.4.0
* app/sanity.c: changed accordingly.
2004-04-15 Sven Neumann <sven@gimp.org>
* app/tools/gimpcropoptions.[ch]
* app/tools/gimpcroptool.[ch]: applied a patch from Jordi Gay that
allows to keep the aspect ratio fixed.
2004-04-15 Michael Natterer <mitch@gimp.org>
* app/core/gimplayermask.c (gimp_layer_mask_class_init): set
translate_desc to "Move Layer Mask".
* app/tools/gimpeditselectiontool.c: take the undo desc
from the moved item's class instead of duplicating all
strings here.
2004-04-15 Sven Neumann <sven@gimp.org>
* app/core/gimppalette-import.[ch]
* app/gui/palette-import-dialog.c: added palette import from RIFF
palette files based on a patch from ÉRDI Gergõ (bug #129788).
2004-04-15 Michael Natterer <mitch@gimp.org>
* app/xcf/xcf.c (xcf_save_invoker) (xcf_load_invoker): forgot
to add context parameters to this non-generated PDB invokers.
Fixes XCF loading/saving.
2004-04-15 Michael Natterer <mitch@gimp.org>
* app/core/gimpitem.[ch]: added "const gchar *stroke_desc" to
the GimpItemClass struct and always push an undo group
around GimpItem::stroke().
* app/core/gimpchannel.c
* app/core/gimpselection.c
* app/vectors/gimpvectors.c: set the stroke_desc accordingly
and don't push undo groups.
* app/text/gimptextlayer.c (gimp_text_layer_class_init): set
all of GimpItemClass' undo_descs.
* app/text/gimptextlayer-transform.c: don't push undo groups here.
2004-04-15 Sven Neumann <sven@gimp.org>
* libgimpcolor/gimpcolorspace.c (gimp_rgb_to_hsv): applied patch
from Marco Munari that removes a redundant "if" (bug #133540).
2004-04-15 Sven Neumann <sven@gimp.org>
* plug-ins/ifscompose/ifscompose.c: applied patch from Yeti that
adds spinbuttons instead of simple text entries (bug #138132).
2004-04-15 Sven Neumann <sven@gimp.org>
* plug-ins/common/Makefile.am
* plug-ins/common/plugin-defs.pl
* plug-ins/common/gicon.c: removed the GIcon plug-in (addresses
one aspect of bug #139160).
2004-04-15 Michael Natterer <mitch@gimp.org>
Context cleanup continued:
* app/core/gimpitem.[ch]: added context parameter to
GimpItem::stroke().
* app/core/gimpchannel.c (gimp_channel_stroke)
* app/vectors/gimpvectors.c (gimp_vectors_stroke): use it to get
default values from instead of gimp_get_user_context().
* app/core/gimpselection.c
* app/gui/stroke-dialog.c
* tools/pdbgen/pdb/edit.pdb
* tools/pdbgen/pdb/paths.pdb: changed accordingly.
* app/pdb/edit_cmds.c
* app/pdb/paths_cmds.c: regenerated.
* app/plug-in/plug-in.[ch]: added GimpContext member to the PlugIn
struct. Added context parameter to plug_in_new(),
plug_in_call_query() and plug_in_call_init().
* app/plug-in/plug-in-run.[ch]: added context parameters to
plug_in_run() and plug_in_repeat().
* app/gui/plug-in-commands.c
* app/gui/vectors-commands.c
* app/pdb/procedural_db.c
* app/widgets/gimphelp.c: pass a context to plug_in_run() and
plug_in_repeat().
* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): call
procedures with the plug-in's context.
* app/plug-in/plug-ins.c: use a temporary context for running the
plug-ins' query() and init() functions. Use the same context for
running automatic extensions. This temporarily separates the main
Script-Fu extension from the user context (i.e. scripts have no
way of setting/getting the global FG, BG, brush etc.).
2004-04-15 Sven Neumann <sven@gimp.org>
* NEWS
* README: mention that this is the development branch.
2004-04-15 Sven Neumann <sven@gimp.org>
* app/paint-funcs/paint-funcs.[ch]:
* app/paint-funcs/paint-funcs-generic.h: header cleanup, added
some const qualifiers, converted tabs to spaces. Fixes bug #140115
for the HEAD branch.
2004-04-15 Michael Natterer <mitch@gimp.org>
Get rid of the "current_context" which was in fact just a bunch of
global variables. Instead, pass the needed context all the way
from the GUI and the PDB to the core. This is a prerequisite for
macro recording and generally helps separating the various
subsystems from each other. Work in progress...
* app/core/gimp.[ch]: removed member "current_context" and
gimp_[get|set]_current_context().
* app/core/gimp-edit.[ch]
* app/core/gimpdrawable-blend.[ch]
* app/core/gimpdrawable-bucket-fill.[ch]
* app/core/gimpdrawable-offset.[ch]
* app/core/gimpdrawable-transform.[ch]
* app/core/gimpimage-crop.[ch]
* app/core/gimpimage-flip.[ch]
* app/core/gimpimage-merge.[ch]
* app/core/gimpimage-resize.[ch]
* app/core/gimpimage-rotate.[ch]
* app/core/gimpimage.[ch]
* app/core/gimpimagefile.[ch]
* app/core/gimpitem-linked.[ch]
* app/core/gimpitem.[ch]
* app/core/gimplayer.[ch]
* app/core/gimpselection.[ch]
* app/core/gimptemplate.[ch]
* app/file/file-open.[ch]
* app/file/file-save.[ch]
* app/pdb/procedural_db.[ch]
* app/text/gimptext-compat.[ch]
* app/text/gimptextlayer-transform.[ch]
* app/gui/brush-select.[ch]
* app/gui/font-select.[ch]
* app/gui/gradient-select.[ch]
* app/gui/palette-select.[ch]
* app/gui/pattern-select.[ch]: added tons of "GimpContext *context"
parameters and use the passed context instead of
gimp_get_current_context().
* app/app_procs.c
* app/batch.c
* app/core/gimpchannel.c
* app/core/gimpdrawable.c
* app/paint/gimperaser.c
* app/paint/gimppaintbrush.c
* app/plug-in/plug-in-message.c
* app/plug-in/plug-ins.c
* app/text/gimptextlayer.c
* app/tools/gimpblendtool.c
* app/tools/gimpbucketfilltool.c
* app/tools/gimpcroptool.c
* app/tools/gimpeditselectiontool.c
* app/tools/gimpfliptool.c
* app/tools/gimpinktool.c
* app/tools/gimptransformtool.c
* app/vectors/gimpvectors.c
* app/gui/convert-dialog.c
* app/gui/drawable-commands.c
* app/gui/edit-commands.c
* app/gui/file-commands.c
* app/gui/file-new-dialog.c
* app/gui/file-open-dialog.c
* app/gui/file-save-dialog.c
* app/gui/image-commands.c
* app/gui/layers-commands.c
* app/gui/offset-dialog.c
* app/gui/select-commands.c
* app/gui/vectors-commands.c
* app/widgets/gimpdnd.c
* app/widgets/gimpdocumentview.c
* app/widgets/gimphelp.c
* app/widgets/gimpthumbbox.c: pass gimp_get_user_context() or
GIMP_CONTEXT(tool_options) or whatever is the right context
to the changed core functions.
* tools/pdbgen/app.pl: pass "GimpContext *context" to all
generated PDB invokers.
* tools/pdbgen/pdb/brush_select.pdb
* tools/pdbgen/pdb/brushes.pdb
* tools/pdbgen/pdb/drawable.pdb
* tools/pdbgen/pdb/edit.pdb
* tools/pdbgen/pdb/font_select.pdb
* tools/pdbgen/pdb/gradient_select.pdb
* tools/pdbgen/pdb/gradients.pdb
* tools/pdbgen/pdb/image.pdb
* tools/pdbgen/pdb/layer.pdb
* tools/pdbgen/pdb/paint_tools.pdb
* tools/pdbgen/pdb/palette.pdb
* tools/pdbgen/pdb/palette_select.pdb
* tools/pdbgen/pdb/palettes.pdb
* tools/pdbgen/pdb/paths.pdb
* tools/pdbgen/pdb/pattern_select.pdb
* tools/pdbgen/pdb/patterns.pdb
* tools/pdbgen/pdb/selection.pdb
* tools/pdbgen/pdb/text_tool.pdb
* tools/pdbgen/pdb/transform_tools.pdb: pass the new context
parameter to the changed core functions.
* app/pdb/*_cmds.c: regenerated.
2004-04-14 Raphaël Quinet <quinet@gamers.org>
* plug-ins/script-fu/scripts/copy-visible.scm: New version of the
script that works on a temporary copy of the image instead of
copying the visible layers. Fixes bug #139989.
2004-04-14 Sven Neumann <sven@gimp.org>
* plug-ins/common/film.c: fixed typo (bug #140039).
2004-04-14 Sven Neumann <sven@gimp.org>
* configure.in: bumped version to 2.1.0, interface age 0, binary
age 0. Changed library versioning to include gimp_minor_version
similar to how gtk+ does it.
2004-04-14 Sven Neumann <sven@gimp.org>
* Made 2.0.1 release.
2004-04-13 Raphaël Quinet <quinet@gamers.org>
* plug-ins/common/mng.c (query, run): Workaround for bug #139947:
do not register the plug-in for INDEXED* modes and do not declare
that it can handle INDEXED images in gimp_export_image(). This
forces a conversion to RGB instead of generating broken indexed
images. The generation of correct indexed MNG files is likely to
require a newer release of libmng.
(mng_data): Set default compression level to 9 instead of 6.
2004-04-13 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_cern_parse.c
* plug-ins/imagemap/imap_csim_parse.c
* plug-ins/imagemap/imap_ncsa_parse.c: regenerated using GNU Bison
version 1.875a. Fixes bug #139894.
2004-04-13 Sven Neumann <sven@gimp.org>
* tools/gimp-remote.c: reverted last change and go back to the
solution using fork(). Hopefully fixes bug #139158 this time.
2004-04-13 Sven Neumann <sven@gimp.org>
* app/core/gimp-utils.[ch] (gimp_get_default_language): added a
category parameter to make this function more flexible.
* app/text/gimptext.c: changed accordingly.
* app/widgets/gimphelp.c (gimp_help): localize the help pages
according to the value of LC_MESSAGES. Fixes bug #139917.
2004-04-13 Michael Natterer <mitch@gimp.org>
Moved the calls to floating_sel_relax()/rigor() from various
places to two single spots in the core where they are actually
needed. Fixes bug #138356 (which was caused by the projection
being triggered in the middle of changing the floating selection's
size or the size of the drawable it is attached to). This commit
effectively removes floating selection fiddling from the core's
public API.
* app/core/gimpdrawable.[ch] (gimp_drawable_has_floating_sel): new
function which returns TRUE if there is a floating selection
attached to the drawable.
* app/core/gimpdrawable.c (gimp_drawable_translate)
(gimp_drawable_set_tiles_full): if the drawable *has* a floating
selection, relax/rigor it before/after modifying the drawable.
* app/core/gimplayer.c (gimp_layer_translate)
(gimp_layer_set_tiles): if the layer *is* the floating selection,
relax/rigor it before/after modifying it.
* app/core/gimpdrawable-transform.c
* app/core/gimpimage-convert.c
* app/core/gimpimage-crop.c
* app/core/gimpimage-flip.c
* app/core/gimpimage-resize.c
* app/core/gimpimage-rotate.c
* app/core/gimpimage-scale.c
* app/gui/layers-commands.c
* app/tools/gimpeditselectiontool.c
* tools/pdbgen/pdb/layer.pdb: removed calls to
floating_sel_rigor()/relax() all over the place. Also removed
lots of undo groups which are obsolete now.
* app/pdb/layer_cmds.c: regenerated.
2004-04-13 Sven Neumann <sven@gimp.org>
* plug-ins/imagemap/imap_file.c (do_file_error_dialog): convert
the filename to UTF-8 before displaying it.
2004-04-13 Michael Natterer <mitch@gimp.org>
GimpItem undo group cleanup in preparation of fixing bug #138356:
* app/core/core-enums.[ch]: renamed LAYER_SCALE and LAYER_RESIZE
undo groups to ITEM_SCALE and ITEM_RESIZE.
* app/core/gimpitem.[ch]: always push undo groups around
GimpItem::translate(), scale(), resize(), flip(), rotate() and
transform(). Added the resp. undo_desc strings to GimpItemClass.
* app/core/gimpchannel.[ch]
* app/core/gimpdrawable.[ch]
* app/core/gimplayer.c: removed all undo groups from
implementations of the above methods. Removed the undo_desc
strings which were moved to GimpItemClass.
* app/core/gimpimage-crop.c
* app/core/gimpselection.c
* app/gui/layers-commands.c
* app/vectors/gimpvectors.c
* tools/pdbgen/pdb/layer.pdb: changed accordingly.
* app/pdb/layer_cmds.c: regenerated.
2004-04-12 Sven Neumann <sven@gimp.org>
* configure.in: cleaned up the check for Xmu. Include <gdk/gdkx.h>
when testing for Xmu.h. Fixes bug #139803.
2004-04-12 Sven Neumann <sven@gimp.org>
* libgimpmath/Makefile.am: remove test-md5 on make clean.
2004-04-11 Manish Singh <yosh@gimp.org>
* plug-ins/pygimp/plug-ins/py-slice.py: When using a separate dir for
images, actually prepend the dir to the img srcs in the html. Allow
only horizontal or vertical guides in an image, do not require both.
A bit smarter path handling. Addresses most of bug #138714.
2004-04-11 Hans Breuer <hans@breuer.org>
* app/makefile.msc : build sanity.obj
app/text/makefile.msc : gimptextundo.obj
app/widgets/makefile.msc : gimppatternfactoryview.obj
* plug-ins/common/winclipboard.c : don't call
gimp_image_undo_enable() when it's not switched off.
Otherwise the undo history would be destroyed with
Gimp-Core-CRITICAL **: file gimpimage.c: line 1579: assertion
`gimage->undo_freeze_count > 0' failed
2004-04-10 Sven Neumann <sven@gimp.org>
* app/tools/gimptexttool.c (gimp_text_tool_apply): push an undo
group only when it's needed. This resurrects text undo compression
that broke when bug #137767 got fixed.
2004-04-10 Sven Neumann <sven@gimp.org>
* docs/gimp-remote.1.in: updated example URL.
2004-04-10 Pedro Gimeno <pggimeno@wanadoo.es>
* app/core/gimpdrawable-transform.c
(gimp_drawable_transform_tiles_affine): Applied patch from William
Skaggs that addresses bug #120490.
* app/sanity.c (sanity_check): Modified the message that reports
an old version of Fontconfig in an attempt to make it more
informative.
2004-04-10 Sven Neumann <sven@gimp.org>
* tools/gimp-remote.c (start_new_gimp): reverted the last change
and did a different fix that involves closing the X display before
starting gimp (bug #139158).
2004-04-09 Manish Singh <yosh@gimp.org>
* plug-ins/common/jpeg.c: Uglier workaround for bug #138357, since
the previous one did break error handling. Fixes bug #139571.
2004-04-09 Henrik Brix Andersen <brix@gimp.org>
* README.i18n: s/14/20/ plus whitespace clean-up.
2004-04-08 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/siod-wrapper.c: applied a patch from Kevin
Cozens that makes the Script-Fu PDB marshaller handle NULL
strings. Some minor code cleanup. Fixes bug #139386.
2004-04-08 Sven Neumann <sven@gimp.org>
* tools/gimp-remote.c (start_new_gimp): applied a patch from
Michael Matz that calls fork() before starting gimp. This is to
avoid X server authentification problems (bug #139158).
2004-04-07 Henrik Brix Andersen <brix@gimp.org>
* configure.in (ALL_LINGUAS): revert addition of "is" until all
.po files are there.
2004-04-07 Samúel Jón Gunnarsson <sammi@techattack.nu>
* configure.in: Added "is" to ALL_LINGUAS
2004-04-06 Iñaki Larrañaga <dooteo@euskalgnu.org>
* configure.in: Added "eu" (Basque) to ALL_LINGUAS.
2004-04-05 Pedro Gimeno <pggimeno@wanadoo.es>
* plug-ins/script-fu/scripts/copy-visible.scm: Use
gimp-image-get-active-layer/channel instead of the passed
drawable for later restoring the initially active layer/channel.
Addresses bug #138662.
* plug-ins/script-fu/scripts/drop-shadow.scm: Add a call to
gimp-image-set-active-layer in order for it to fail early instead
of failing with the undo group open in case the drawable is not
suitable for applying the effect.
2004-04-05 Michael Natterer <mitch@gimp.org>
* app/core/gimpimage.c (gimp_image_real_mode_changed): update the
whole image.
* app/display/gimpdisplay-handlers.c: removed obsolete
"mode_changed" and "colormap_changed" handlers because GimpImage's
default handlers already update the whole image.
2004-04-05 Pedro Gimeno <pggimeno@wanadoo.es>
Sanitize rectangle and ellipse selection handling (bug #138237
and bug #138103):
* app/tools/gimprectselecttool.h
* app/tools/gimprectselecttool.c (GimpRectSelectTool): new
member "moved" indicating whether the cursor was moved after
the click.
(gimp_rect_select_tool_coords_to_integer): New function for
consistent conversion of the rectangle FP coords to pixels.
(gimp_rect_select_tool_button_press,
gimp_rect_select_tool_button_release,
gimp_rect_select_tool_motion, gimp_rect_select_tool_draw): use
it instead of fiddling with the FP coordinates. Update "moved"
and use it to detect whether the selection needs to be cleared.
* app/tools/gimpellipseselecttool.c
(gimp_ellipse_select_tool_draw): use the new coords_to_integer
function.
2004-04-05 Sven Neumann <sven@gimp.org>
* plug-ins/Lighting/lighting_ui.c: applied the second patch
attached to bug #138788 by William Skaggs. Removes some user
interface elements that have no corresponding implementation and
fixes preview updates.
2004-04-04 Sven Neumann <sven@gimp.org>
* Makefile.am
* NEWS.pre-2-0: moved old NEWS to this new file.
* NEWS: list bugs fixed since 2.0.0.
2004-04-04 Sven Neumann <sven@gimp.org>
* Makefile.am
* docs/Makefile.am: don't install gimptool symlinks to
gimptool-2.0 and its manpage. gimp.m4 as installed with gimp-1.2
looks for gimptool (bug #139024).
2004-04-04 Sven Neumann <sven@gimp.org>
* app/display/gimpdisplayshell-callbacks.c
* app/display/gimpdisplayshell-draw.[ch] pass the bounding box of
the exposed area to gimp_display_shell_draw_grid() and draw only
the relevant part of the grid. Fixes bug #138081.
2004-04-04 Sven Neumann <sven@gimp.org>
Cache the GC for drawing the grid as suggested in bug #138081:
* app/display/gimpdisplayshell.[ch]: added a grid_gc member to
GimpDisplayShell.
* app/display/gimpdisplayshell-handlers.c
(gimp_display_shell_grid_notify_handler)
(gimp_display_shell_disconnect): invalidate the grid GC.
* app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid):
use the cached grid_gc. Also applied the fix that Pedro Gimeno did
for bug #138606.
2004-04-04 Sven Neumann <sven@gimp.org>
* app/core/gimpundo.c (gimp_undo_type_to_name): added a missing
call to gettext(). Fixes bug #139000.
2004-04-03 Manish Singh <yosh@gimp.org>
* gimptool-2.0.in: Create any directories in the install path that do
not already exist. Fixes bug #138980.
* docs/gimptool.1.in: s/dont/don't/g
2004-04-04 Sven Neumann <sven@gimp.org>
* app/core/gimpimagemap.c (gimp_image_map_apply): do nothing if the
selection is empty. Fixes bug #138973.
2004-04-03 Sven Neumann <sven@gimp.org>
* app/text/gimptextlayer.c (gimp_text_layer_new): create the
initial text layer with a size of 1 x 1 since tile_manager_new()
does not any longer accept 0 x 0.
* app/core/gimpdrawable.c (gimp_drawable_configure): check that
width and height are > 0.
2004-04-03 Sven Neumann <sven@gimp.org>
* plug-ins/Lighting/lighting_main.c
* plug-ins/Lighting/lighting_shade.c: applied the first of two
patches attached to bug #138788 by William Skaggs.
2004-04-02 Simon Budig <simon@gimp.org>
* plug-ins/common/whirlpinch.c: set a proper pixelfetcher
edge mode for bigger radii. Avoids getting garbage at the
image borders.
2004-04-02 Dave Neary <bolsh@gimp.org>
* plug-ins/common/jpeg.c: Added .jpe to the list of extensions
that the jpeg plug-in recognises. Fixes bug #138776.
2004-04-01 Sven Neumann <sven@gimp.org>
* app/gui/user-install-dialog.c: unset the bg_pixmap and tweak
style colors for all states. Sort of ugly but makes the dialog
work better with more obscure themes (bug #138379).
2004-04-01 Sven Neumann <sven@gimp.org>
* tools/kernelgen.c: updated a comment.
2004-04-01 Michael Natterer <mitch@gimp.org>
* app/core/core-enums.[ch] (enum GimpUndoType): added undo type
GIMP_UNDO_TEXT_LAYER_MODIFIED and undo group types
GIMP_UNDO_GROUP_DRAWABLE and GIMP_UNDO_GROUP_DRAWABLE_MOD.
* app/core/gimpimage-undo-push.[ch]: added new new function
gimp_image_undo_push_text_layer_modified() which makes
modifications of the text_layer's "modified" boolean undoable.
* app/core/gimpdrawable.[ch]: added new virtual function
GimpDrawable::push_undo() and moved the actual undo pushing into
the default implementation gimp_drawable_real_push_undo().
* app/text/gimptextlayer.c (gimp_text_layer_push_undo): new
function. Pushes the text_layer's modified state to the undo stack
after upchaining and sets modified to TRUE.
(gimp_text_layer_set_tiles): ditto.
(gimp_lext_layer_apply_region)
(gimp_text_layer_replace_region): removed because their default
implementations already call gimp_drawable_push_undo().
(gimp_text_layer_swap_pixels): removed because swap_pixels() is
used by undo only and doesn't need to care about the text_layer's
modified state.
(gimp_text_layer_render): don't set modified to FALSE here because
we can't push an undo step here.
(gimp_text_layer_set): push the modified state to the undo stack
and set it to FALSE here. Also push the layer's tiles if the
layer was modified.
* app/tools/gimptexttool.c (gimp_text_tool_apply): push "modified"
to the undo stack and set it to FALSE here, too.
Fixes bug #137767.
2004-03-31 Simon Budig <simon@gimp.org>
* app/tools/gimptransformtool.c: One really should use braces
when mixing additions and multiplication and the operator
precedence is not the desired one...
I feel stupid... :-)
2004-03-31 Michael Natterer <mitch@gimp.org>
* app/core/gimp-transform-utils.c
(gimp_transform_matrix_perspective): make sure 0.0/0.0 results
in 1.0, not NaN.
* app/core/gimpdrawable-transform.c
(gimp_drawable_transform_tiles_affine): instead of returning NULL
if the transformation shrinks the tiles completely away, return at
least the pixel (or the row or column of pixels) which best covers
the sub-pixel area of the transform result:
- Changed rounding of the transformed coordinates from RINT()
to floor()/ceil() so we don't cut off sub-pixel portions of the
transform result.
- Force the minimal size if the changed rounding didn't help.
Fixes bug #138117.
Also added paranoia code which falls back to clip_result if the
passed matrix produces NaN coordinates (copied the FINITE() macro
from image_cmds.c).
2004-03-30 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/grid-system.scm: define "map" here,
the script used to take the definition from alien-glow-arrow.scm
or beveled-pattern-arrow.scm. Also added an undo group around all
operations. Fixes bug #138524.
2004-03-30 Michael Natterer <mitch@gimp.org>
* app/Makefile.am
* app/sanity.[ch]: new files implementing sanity_check() for
run-time checking library versions. Added a check for FreeType but
disabled it until we figured if and how freetype causes some of
the DLL hell bugs.
* app/main.c (main): call it and abort if it fails.
* app/app_procs.[ch]: added app_gui_abort() so main.c doesn't
need to #include "gui/gui.h"
* app/gui/gui.[ch] (gui_libs_init): removed library sanity checking.
(gui_abort): new function which shows the abort message.
2004-03-30 Michael Natterer <mitch@gimp.org>
* configure.in (ALL_LINGUAS): revert addition of "pa" until
all .po files are there.
2004-03-20 Guntupalli Karunakar <karunakar@freedomink.org>
* configure.in: Added "pa" for Punjabi to ALL_LINGUAS.
2004-03-29 Manish Singh <yosh@gimp.org>
* plug-ins/common/jpeg.c (struct my_error_mgr): Move setjump_buffer
to the beginning of the structure, to make sure it is aligned on a
16-byte boundary for ia64, even with icc. Fixes #138357.
2004-03-29 Sven Neumann <sven@gimp.org>
* app/config/gimpguiconfig.c: changed the default for "help-locales"
from NULL to an empty string. Fixes the generated gimprc man-page.
* app/config/gimprc-blurbs.h (HELP_LOCALES_BLURB): added missing
whitespace.
* app/widgets/gimphelp.c: use the user's locale if "help-locales"
is NULL or the empty string.
* docs/gimprc.5.in
* etc/gimprc: regenerated.
2004-03-29 Michael Natterer <mitch@gimp.org>
* app/core/core-enums.[ch] (enum GimpUndoType): added new group
GIMP_UNDO_GROUP_FS_REMOVE.
* app/core/gimplayer-floating-sel.c (floating_sel_remove): push an
undo group. Fixes undo corruption spotted by Pedro Gimeno.
2004-03-29 Michael Natterer <mitch@gimp.org>
* plug-ins/common/guillotine.c (guillotine): Don't just skip
guides at the image edges but any guide which is at a position we
already remembered. Should catch all instances of bug #138312 this
time.
2004-03-28 Sven Neumann <sven@gimp.org>
* plug-ins/ifscompose/ifscompose.c: applied patch from David Necas
that updates the sensitivity of the Delete button and menu entry.
Fixes bug #138212.
2004-03-28 Sven Neumann <sven@gimp.org>
* plug-ins/MapObject/mapobject_main.c: fixed non-interactive call.
* plug-ins/script-fu/scripts/spinning-globe.scm: pass -1 as
drawable ID for unused drawables. Fixes bug #138253.
2004-03-28 Sven Neumann <sven@gimp.org>
* app/text/gimpfontlist.c (gimp_font_list_add_font): validate the
font name. This should work around the crashes that Windows users
were experiencing on startup (bug #132366). The real problem needs
to be fixed elsewhere though.
2004-03-28 Michael Natterer <mitch@gimp.org>
* app/core/gimpimage-undo-push.c (undo_pop_layer): when re-adding
a layer with mask, don't forget to set layer->mask->removed to FALSE.
2004-03-28 Michael Natterer <mitch@gimp.org>
* app/core/gimpitem.[ch]: added "gboolean removed" to the GimpItem
struct. Defaults to FALSE. Set it to TRUE in gimp_item_removed().
Added public function gimp_item_is_removed().
* app/core/gimpimage-undo-push.c (undo_pop_layer)
(undo_pop_layer_mask) (undo_pop_channel) (undo_pop_vectors):
set it to FALSE manually when re-adding something from the
undo stack.
* tools/pdbgen/app.pl
* tools/pdbgen/pdb.pl: don't allow any operation on items which
are removed from the image (and exist on the undo stack only).
Fixes bug #138311.
* app/pdb/channel_cmds.c
* app/pdb/color_cmds.c
* app/pdb/drawable_cmds.c
* app/pdb/edit_cmds.c
* app/pdb/floating_sel_cmds.c
* app/pdb/image_cmds.c
* app/pdb/layer_cmds.c
* app/pdb/paint_tools_cmds.c
* app/pdb/parasite_cmds.c
* app/pdb/selection_cmds.c
* app/pdb/selection_tools_cmds.c
* app/pdb/transform_tools_cmds.c: regenerated.
2004-03-28 Sven Neumann <sven@gimp.org>
* plug-ins/script-fu/scripts/slide.scm: applied a (modified) patch
from Nils Philippsen that fixes bug #138310.
2004-03-28 Michael Natterer <mitch@gimp.org>
* plug-ins/common/guillotine.c (guillotine): applied a (modified)
patch from Joao S. O. Bueno which removes any guides from the
cropped images. Fixes bug #138314.
Skip guides which are at the image's edges because the algorithm
already assumes that there are always guides at these positions.
Fixes bug #138312.
2004-03-27 Tor Lillqvist <tml@iki.fi>
* plug-ins/help/Makefile.am (AM_LDFLAGS): Use -mwindows on Windows
to avoid a console window popping up.
2004-03-26 Manish Singh <yosh@gimp.org>
* tools/pdbgen/app.pl: don't generate code with tabs.
* tools/pdbgen/pdb/procedural_db.pdb: convert tabs to spaces in
helper function declaration.
* app/pdb/procedural_db.c: convert tabs to spaces.
* app/pdb/*.c: regenerated, no code changes, only tabs->spaces.
2004-03-26 Manish Singh <yosh@gimp.org>
* tools/pdbgen/app.pl: kill whitespace in blank lines.
* app/pdb/*.c: regenerated, no code changes, only whitespace.
2004-03-26 Michael Natterer <mitch@gimp.org>
* app/core/gimpdrawable-transform.c
(gimp_drawable_transform_tiles_affine): return NULL tiles if the
matrix would transform the drawable into nothing. Fixes the
core-crashing part of bug #138117 and makes the script fail
with an execution error.
2004-03-25 Sven Neumann <sven@gimp.org>
* README: mention the gimp-perl pre-release and provide a link.
2004-03-25 Michael Natterer <mitch@gimp.org>
* app/base/tile-manager.c (tile_manager_new): g_return_if_fail()
on width, height or bpp <= 0. Doesn't fix anything but badly
warns (and helps debugging) on bug #138117.
2004-03-25 Michael Natterer <mitch@gimp.org>
* app/tools/gimpvectortool.c (gimp_vector_tool_button_release):
fixed condition which triggers the path tool's undo hack. Fixes
bug #138086. Also g_object_unref() the undo step.
Removed trailing whitespace.
2004-03-25 Manish Singh <yosh@gimp.org>
* libgimp/gimp.c
* app/plug-in/plug-in-shm.c: close the shm_open fd in the POSIX
shm case. We were leaking an fd here.
* app/tools/gimptexttool.c (gimp_text_tool_connect): remove
unnecessary G_OBJECT() cast in g_object_set() call.
2004-03-23 Michael Natterer <mitch@gimp.org>
* autogen.sh: be verbose about AUTOGEN_CONFIGURE_ARGS in the
message that is printed if no arguments were passed.
2004-03-23 Sven Neumann <sven@gimp.org>
Michael Natterer <mitch@gimp.org>
* Made 2.0.0 release.
Reference in New Issue View Git Blame Copy Permalink